[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69627.1
DDBJ      :             putative cytoplasmic protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  84/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->151 PF10722 * YbjN 1e-54 72.8 %
:HMM:PFM   1->158 PF10722 * YbjN 1.1e-72 60.5 157/157  
:BLT:SWISS 1->158 YBJN_SHIFL 1e-67 77.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69627.1 GT:GENE ACF69627.1 GT:PRODUCT putative cytoplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 994827..995303 GB:FROM 994827 GB:TO 995303 GB:DIRECTION + GB:PRODUCT putative cytoplasmic protein GB:PROTEIN_ID ACF69627.1 GB:DB_XREF GI:194409408 LENGTH 158 SQ:AASEQ MISLVVPTLDTLRQWLDDLGMNFFECDTCQALHLPHMQNFDGVYDAKIDLVDNTVLFSAMAEVRPSALLPLAADLSAINASSLTVKAFLDMQDDNLPKLVVCQSLSVMQGVTYEQFEWFVRQSEEQISMVILEAGAHQLLFNAEEDAQKTSAVDHFLH GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 1->158|YBJN_SHIFL|1e-67|77.2|158/158| SEG 65->77|psallplaadlsa| RP:PFM:NREP 1 RP:PFM:REP 1->151|PF10722|1e-54|72.8|151/154|YbjN| HM:PFM:NREP 1 HM:PFM:REP 1->158|PF10722|1.1e-72|60.5|157/157|YbjN| OP:NHOMO 84 OP:NHOMOORG 84 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111--------------11----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,152-153| PSIPRED ccEEEEccHHHHHHHHHHHcccEEEcccccEEcccccccccccEEcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccEEEEEEEEcccccccEEEEEHHHHHHHcccHHHHHHHHHHHHHHHEEEEEEcccccEEEccccccccccccccccc //