[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69632.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:288 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   103->248 1g95A PDBj 9e-05 28.2 %
:BLT:SWISS 56->114 YQHT_BACSU 8e-04 35.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69632.1 GT:GENE ACF69632.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1543589..1544455) GB:FROM 1543589 GB:TO 1544455 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69632.1 GB:DB_XREF GI:194409413 LENGTH 288 SQ:AASEQ MTKKLTAIILAAGLASGCATTTNNYQYKGDHSRAYNLAQAGGLYDARDYDIPRDQRDGVISKGWDVTGDALLFNSGHGLGLDWGKSLGLGLLTSAFAPKGVMERDSVFGWVPETKAGDAGEAWELMSNTLLDGIEKSLQQANVDYIVDNRNLHQDLPLVSEYIFSSVRIVAPEHGCPDWETANRDYDQSCYVATTVYAPTEEPRKVPDFLTAEPNGYGFYANDEADYSRIKVNIPKGSNMDKNQLLAGISRELPAWAFIFVASQKLDTGGYTAPVILTAGKAELFIQL GT:EXON 1|1-288:0| BL:SWS:NREP 1 BL:SWS:REP 56->114|YQHT_BACSU|8e-04|35.7|56/100| BL:PDB:NREP 1 BL:PDB:REP 103->248|1g95A|9e-05|28.2|142/445| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 49.3 SQ:SECSTR ######################################################################################################EccccTTccEEEc#cTTccccEEEcTTTccTTGGGccEEEEEEEEEHHHHHHHTTTcccccTTHHHHHHHHTTccEEEEEEccGGGGcccccHHHHHHHHHHHHHH##HHHHTTcEE#ccGGGcEEcTTcEEcTTcEEccccEEEc######################################## DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccHHHHHccccccccccHHHHHHHHHHHHHccccccccccHHHcccHHHcccHHHHHHHHHHHHHHHHHHHHHHccccEEEcccHHHHccccccccEEEEEEEEcccccccccccccccccccEEEEEEEEcccccccccccHHcccccccccEEcccccEEEEEEEccccccccHHHHHHHHHHccccEEEEEEEccccccccccccHHHHcccEEEEEcc //