[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69645.1
DDBJ      :             multidrug resistance protein MdtA
Swiss-Prot:MDTA_SALHS   RecName: Full=Multidrug resistance protein mdtA;AltName: Full=Multidrug transporter mdtA;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  514/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.3.1d.41.2f.46.1
:413 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   79->390 2v4dB PDBj 3e-26 28.5 %
:RPS:PDB   25->118 3bg5B PDBj 3e-09 12.8 %
:RPS:PDB   191->253 2ejmA PDBj 2e-07 18.0 %
:RPS:PDB   225->405 3bsdA PDBj 3e-11 8.0 %
:RPS:SCOP  79->135 1qpnA2  d.41.2.1 * 1e-09 14.0 %
:RPS:SCOP  143->413 1iu4A  d.3.1.8 * 8e-34 8.3 %
:HMM:SCOP  72->315 1vf7A_ f.46.1.1 * 1.5e-49 37.8 %
:RPS:PFM   87->218 PF00529 * HlyD 8e-13 36.4 %
:HMM:PFM   85->374 PF00529 * HlyD 2.7e-30 23.6 288/306  
:BLT:SWISS 1->413 MDTA_SALHS 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69645.1 GT:GENE ACF69645.1 GT:PRODUCT multidrug resistance protein MdtA GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2261873..2263114 GB:FROM 2261873 GB:TO 2263114 GB:DIRECTION + GB:PRODUCT multidrug resistance protein MdtA GB:NOTE identified by match to protein family HMM PF00529; match to protein family HMM TIGR01730 GB:PROTEIN_ID ACF69645.1 GB:DB_XREF GI:194409426 LENGTH 413 SQ:AASEQ MKGSNTFRWAIAIGVVVAAAAFWFWHSRSESPTAAPGVAAQAPHTAAAGRRGMRDGPLAPVQAATATTQAVPRYLSGLGTVTAANTVTVRSRVDGQLIALHFQEGQQVNAGDLLAQIDPSQFKVALAQAQGQLAKDNATLANARRDLARYQQLAKTNLVSRQELDAQQALVNETQGTIKADEANVASAQLQLDWSRITAPVSGRVGLKQVDVGNQISSSDTAGIVVITQTHPIDLIFTLPESDIATVVQAQKAGKTLVVEAWDRTNSHKLSEGVLLSLDNQIDPTTGTIKIKARFTNQDDTLFPNQFVNARMLVDTEQNAVVVPAAAVQMGNEGHFVWVLNDENNVSKMRVKIGIQDNQNVVISAGLSAGDRVVTDGIDRLTEGAKVEVVEPQTTMADEKSPSRHEGQKGARA GT:EXON 1|1-413:0| SW:ID MDTA_SALHS SW:DE RecName: Full=Multidrug resistance protein mdtA;AltName: Full=Multidrug transporter mdtA;Flags: Precursor; SW:GN Name=mdtA; OrderedLocusNames=SeHA_C2356; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Repeat; Signal; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->413|MDTA_SALHS|0.0|100.0|413/413| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 1 TM:REGION 3->24| SEG 10->21|aiaigvvvaaaa| SEG 59->72|apvqaatattqavp| SEG 320->328|avvvpaaav| BL:PDB:NREP 1 BL:PDB:REP 79->390|2v4dB|3e-26|28.5|295/327| RP:PDB:NREP 3 RP:PDB:REP 25->118|3bg5B|3e-09|12.8|94/1074| RP:PDB:REP 191->253|2ejmA|2e-07|18.0|61/99| RP:PDB:REP 225->405|3bsdA|3e-11|8.0|176/359| RP:PFM:NREP 1 RP:PFM:REP 87->218|PF00529|8e-13|36.4|132/259|HlyD| HM:PFM:NREP 1 HM:PFM:REP 85->374|PF00529|2.7e-30|23.6|288/306|HlyD| GO:PFM:NREP 3 GO:PFM GO:0008565|"GO:protein transporter activity"|PF00529|IPR006143| GO:PFM GO:0009306|"GO:protein secretion"|PF00529|IPR006143| GO:PFM GO:0016020|"GO:membrane"|PF00529|IPR006143| RP:SCP:NREP 2 RP:SCP:REP 79->135|1qpnA2|1e-09|14.0|57/115|d.41.2.1| RP:SCP:REP 143->413|1iu4A|8e-34|8.3|266/331|d.3.1.8| HM:SCP:REP 72->315|1vf7A_|1.5e-49|37.8|230/237|f.46.1.1|1/1|HlyD-like secretion proteins| OP:NHOMO 2656 OP:NHOMOORG 519 OP:PATTERN -------------------------------------------------------------------- 558--------------------------------------------------------------------------------11-327977-911----29442C7D39--------------121123112442----------13--11---111----121-41141-2-----2-----1-----1----------------------------------------2------------------------------------------------1----------------------------------------------2-------1-1-------------1--2-224211----------1543922322222AAIDD857ECBB577877878889-8A979C7B1A6-C99AAA9BC8788D331-2634333123333333355624467------------1-12-121-1111------1313566369DDBD88455477BA77774699C6889-344725546B653534962958762222222646336-263244235544315537566573344735832212222222-2-------231-344764672558847788857CA88AA9DEAB8--16325------66552736777677866-7666777676786666666787543356554566666546445666443463-777777766777--2233134575563954332223211111111444243511-66BBBCCCBF777885AAC11111111136675555557A666CD96A664652222--1-221111----------------------------------------------575 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1-------1--------------4-----7---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 381 STR:RPRED 92.3 SQ:SECSTR ########################EEEEEEcccccccccccccccTTcTTEEEccccEEEEEEcccTTcEEcTTcEEEEEEccccEEEEEccccEEEEEEcccTTcEEcTTcEEEEEcTccEEEEEccGGGGGccccHHHHHHHHHHHHHHHHHTTTcccHHHHHHHEEEEETTEEEEEEEEccccccccccccccccccccEEEEEEcccTTEEEccccEccEcEEEEEEEEEEccTTccEEEEEEEEEEccccccEEEEEEEEETTTTEEEEEEEEEEEETTEEEEEEEEEEEEEccccEEEEEEEEEEEETTEEEEEEEEEEEEEEEccccHHHHHHccccccccEEEcccEEEEEEEEEEEccccHHHHHHHHHHHHccccccHHHHHHHHHcTTTHHHHH######## DISOP:02AL 1-4,38-61,388-414| PSIPRED ccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccccccccccccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEccccEEEEEEcccccEEEcccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccEEEEEEEEccccEEcccccEEEEEEEEcccEEEEEEEcHHHHHHHccccccccEEEEEEEEcccccEEEEEEEEEEccccccccEEEEEEEEEEccccccccccEEEEEEEEcccccEEEccHHHEEEcccccEEEEEccccEEEEEEEEEEEEEccEEEEEEccccccEEEEccHHHcccccEEEEEccccccccccccccccccccccc //