[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69654.1
DDBJ      :             type III secretion system protein, SsaH family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   24->87 PF06287 * DUF1039 6e-05 39.1 %
:HMM:PFM   23->88 PF06287 * DUF1039 2.2e-32 54.5 66/66  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69654.1 GT:GENE ACF69654.1 GT:PRODUCT type III secretion system protein, SsaH family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1495245..1495535 GB:FROM 1495245 GB:TO 1495535 GB:DIRECTION + GB:PRODUCT type III secretion system protein, SsaH family GB:NOTE identified by match to protein family HMM TIGR02498 GB:PROTEIN_ID ACF69654.1 GB:DB_XREF GI:194409435 LENGTH 96 SQ:AASEQ MESLLKSEVISDDVRRLLLEIMFAGVNHSLISQVHAMLPALTVIVPDKKLQLVCLALLLAGLNEPLKAAKILSDIDLPEAMALRLLFPAPNEGFEN GT:EXON 1|1-96:0| TM:NTM 2 TM:REGION 20->42| TM:REGION 50->72| SEG 48->68|kklqlvclalllaglneplka| RP:PFM:NREP 1 RP:PFM:REP 24->87|PF06287|6e-05|39.1|64/66|DUF1039| HM:PFM:NREP 1 HM:PFM:REP 23->88|PF06287|2.2e-32|54.5|66/66|DUF1039| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,91-97| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHcccccccccc //