[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69676.1
DDBJ      :             carnitinyl-CoA dehydratase
Swiss-Prot:CAID_SALTY   RecName: Full=Carnitinyl-CoA dehydratase;         EC=4.2.1.-;AltName: Full=Crotonobetainyl-CoA hydratase;

Homologs  Archaea  34/68 : Bacteria  662/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->261 2qq3I PDBj 3e-32 40.1 %
:RPS:PDB   1->260 1ef9A PDBj 1e-49 25.2 %
:RPS:SCOP  3->256 1dciA  c.14.1.3 * 2e-51 29.7 %
:HMM:SCOP  2->261 1wdkA4 c.14.1.3 * 4.9e-80 43.1 %
:RPS:PFM   16->181 PF00378 * ECH 5e-24 44.8 %
:HMM:PFM   15->180 PF00378 * ECH 8.8e-59 47.3 165/170  
:BLT:SWISS 1->261 CAID_SALTY e-139 100.0 %
:PROS 98->118|PS00166|ENOYL_COA_HYDRATASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69676.1 GT:GENE ACF69676.1 GT:PRODUCT carnitinyl-CoA dehydratase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(76993..77778) GB:FROM 76993 GB:TO 77778 GB:DIRECTION - GB:PRODUCT carnitinyl-CoA dehydratase GB:NOTE identified by match to protein family HMM PF00378 GB:PROTEIN_ID ACF69676.1 GB:DB_XREF GI:194409457 LENGTH 261 SQ:AASEQ MSESLHLTRNGPILEITLDRPKANAIDAKTSFAMGEAFLNFRDDPELRVAIITGGGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVNGYAFGGGFELALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAALKEIYRATSEMPVEEGYRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKGR GT:EXON 1|1-261:0| SW:ID CAID_SALTY SW:DE RecName: Full=Carnitinyl-CoA dehydratase; EC=4.2.1.-;AltName: Full=Crotonobetainyl-CoA hydratase; SW:GN Name=caiD; OrderedLocusNames=STM0070; SW:KW Complete proteome; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->261|CAID_SALTY|e-139|100.0|261/261| GO:SWS:NREP 1 GO:SWS GO:0016829|"GO:lyase activity"|Lyase| PROS 98->118|PS00166|ENOYL_COA_HYDRATASE|PDOC00150| SEG 103->116|gyafgggfelalaa| BL:PDB:NREP 1 BL:PDB:REP 4->261|2qq3I|3e-32|40.1|252/256| RP:PDB:NREP 1 RP:PDB:REP 1->260|1ef9A|1e-49|25.2|258/261| RP:PFM:NREP 1 RP:PFM:REP 16->181|PF00378|5e-24|44.8|165/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 15->180|PF00378|8.8e-59|47.3|165/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 3->256|1dciA|2e-51|29.7|249/275|c.14.1.3| HM:SCP:REP 2->261|1wdkA4|4.9e-80|43.1|255/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 4989 OP:NHOMOORG 862 OP:PATTERN 22-1--4987888877-121211A52211126-----------------------------2321-11 2342A113113211JWLEE-EM55MaEEEEEHPQVQITdk1K3O1-14-222445422--BAE169ED7A5--------1418-----1111-1211--31222142313--------------11111121112154455---4711121111111111111111122111111-111-11122322---7545555545646564452744446645A975411111119-111111111111111111111-1----1-----11---1-111111---111111111111111111111111111111111-1111112--1231111111212-2221221-211-3-11-561427-15---1--2-3--F99K-----51VIL423OHPJF67756675776-2-5-1C278AN-6332437868985B6F6799357787C11111111622-1B85-----------------------------1CHSA-3bREMAGGEOA68887CCFDAAA957IBZKZeW23EE9A79BBFAGHIS228----65----------H8A3V9A1---------16762B12--2444A632---------------------------561681837635544454944444596457----11-------42342347556765688-587865576756566766755533444454444444444444464545555--433333333333---3111111111-7724111111-11112111998793946631A99A6979597987334----------322622222563553332323333-------1554444-----------------------------------------------11 ----663-423-546B753966796989946356768C89797858676798DB674554343---------1----------------5A474542211536546-A95H897B975555682IB4A4LzB-A8F4253956B93577384493697E9F57D762B79E9A884232U33346878F5776487653 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 261 STR:RPRED 100.0 SQ:SECSTR ccccEEEEEETTEEEEEEccGGGTcccHHHHHHHHHHHHHTccTTccEEEEEccTTccEEEccccGGGcccccccTTccccHHHHHHHHHHHccccEEEEEccEEETHHHHHHHTccEEEEETTcEEEccGGGTTccccHHHHHTTTTTccHHHHHHHHHHcccEEHHHHHHTTcccEEEcHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHTTcccccccH DISOP:02AL 259-262| PSIPRED cccEEEEEEEccEEEEEEcccccccccHHHHHHHHHHHHHHHcccccEEEEEEccccccEEccccHHHHHcccHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccc //