[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69703.1
DDBJ      :             acyl-CoA thioester hydrolase YciA
Swiss-Prot:YCIA_SALTY   RecName: Full=Acyl-CoA thioester hydrolase yciA;         EC=3.1.2.-;

Homologs  Archaea  11/68 : Bacteria  436/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->126 1yliB PDBj 3e-43 63.6 %
:RPS:PDB   5->126 3bjkC PDBj 3e-30 69.7 %
:RPS:SCOP  5->126 1yliA1  d.38.1.1 * 1e-51 70.5 %
:HMM:SCOP  3->126 1yliA1 d.38.1.1 * 3.7e-35 41.9 %
:HMM:PFM   23->95 PF03061 * 4HBT 2.3e-21 28.8 73/79  
:BLT:SWISS 1->130 YCIA_SALTY 1e-72 99.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69703.1 GT:GENE ACF69703.1 GT:PRODUCT acyl-CoA thioester hydrolase YciA GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1878618..1879010 GB:FROM 1878618 GB:TO 1879010 GB:DIRECTION + GB:PRODUCT acyl-CoA thioester hydrolase YciA GB:NOTE identified by match to protein family HMM PF03061 GB:PROTEIN_ID ACF69703.1 GB:DB_XREF GI:194409484 LENGTH 130 SQ:AASEQ MDNTPQGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYARCVKRGTTSISINIEVWVKKVASEPIGQRYKATEALFIYVAVDPDGKPRPLTVQG GT:EXON 1|1-130:0| SW:ID YCIA_SALTY SW:DE RecName: Full=Acyl-CoA thioester hydrolase yciA; EC=3.1.2.-; SW:GN Name=yciA; OrderedLocusNames=STM1736; SW:KW Complete proteome; Hydrolase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->130|YCIA_SALTY|1e-72|99.2|130/133| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 6->126|1yliB|3e-43|63.6|121/148| RP:PDB:NREP 1 RP:PDB:REP 5->126|3bjkC|3e-30|69.7|122/142| HM:PFM:NREP 1 HM:PFM:REP 23->95|PF03061|2.3e-21|28.8|73/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 5->126|1yliA1|1e-51|70.5|122/142|d.38.1.1| HM:SCP:REP 3->126|1yliA1|3.7e-35|41.9|124/0|d.38.1.1|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 561 OP:NHOMOORG 450 OP:PATTERN ---------------1--------122-1122-----------------------------111---- -11-11-1111111--------------------------1------1-------------1-----111-----------------------------1111112131211111111111111------------1---1---1--------------------------------------12211---1-1----------------111-1-------1--1111112--1111111111111111111--------------------------------------------------------------------------------------------------1------------------------1111-----11111111-----11111111111-2222222111-112211111111121---21------1111111111111-1131------------------------------1-111111112222222222222222222222231111--2221122222212-111----1-2222222--12121---1-2--11111--1--1111-11111-1--111-111111----------------221-111-11-1111111111111111111--11--11111111112-111111111111-111111111111111111111111112111111111111111111111111--111111111111---------1111-12121111111111-11111111112--11222222121122221111----------233222222121222222212111------1-22----------------------------------------------------1 -----------------------------------------------------------------------------------------------------------1-------------------------------------------------------3------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 97.7 SQ:SECSTR cccccccEEEEEEEccGGGccTTccccHHHHHHHHHHHHHHHHHHHHTccEEEEEEEEEEEcccccTTcEEEEEEEEEEEcccEEEEEEEEEEEccccccTTcEEEEEEEEEEEEEccTTccccccH### DISOP:02AL 1-5,8-8,124-131| PSIPRED ccccccccEEEEEEEcHHHccccccEEHHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEcccccccEEEEEEEEEEEcccEEEEEEEEEEEEccccccccEEEEEEEEEEEEEEcccccEEEccccc //