[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69716.1
DDBJ      :             CDP-abequose synthase
Swiss-Prot:RFBJ_SALTY   RecName: Full=CDP-abequose synthase;         EC=4.2.1.-;AltName: Full=O4 antigen;

Homologs  Archaea  38/68 : Bacteria  236/915 : Eukaryota  64/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->297 2pk3A PDBj 1e-17 27.9 %
:RPS:PDB   8->297 2b69A PDBj 1e-22 16.5 %
:RPS:SCOP  8->294 1sb8A  c.2.1.2 * 2e-30 22.4 %
:HMM:SCOP  7->300 1eq2A_ c.2.1.2 * 5.3e-42 27.1 %
:RPS:PFM   8->216 PF01370 * Epimerase 4e-17 34.8 %
:HMM:PFM   8->229 PF01370 * Epimerase 1.5e-42 29.9 214/238  
:BLT:SWISS 1->299 RFBJ_SALTY e-175 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69716.1 GT:GENE ACF69716.1 GT:PRODUCT CDP-abequose synthase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2217618..2218517) GB:FROM 2217618 GB:TO 2218517 GB:DIRECTION - GB:PRODUCT CDP-abequose synthase GB:NOTE identified by match to protein family HMM PF01370 GB:PROTEIN_ID ACF69716.1 GB:DB_XREF GI:194409497 LENGTH 299 SQ:AASEQ MTFLKEYVIVSGASGFIGKHLLEALKKSGISVVAITRDVIKNNSNALANVRWCSWDNIELLVEELSIDSALIGIIHLATEYGHKTSSLINIEDANVIKPLKLLDLAIKYRADIFLNTDSFFAKKDFNYQHMRPYIITKRHFDEIGHYYANMHDISFVNMRLEHVYGPGDGENKFIPYIIDCLNKKQSCVKCTTGEQIRDFIFVDDVVNAYLTILENRKEVPSYTEYQVGTGAGVSLKDFLVYLQNTMMPGSSSIFEFGAIEQRDNEIMFSVANNKNLKAMGWKPNFDYKKGIEELLKRL GT:EXON 1|1-299:0| SW:ID RFBJ_SALTY SW:DE RecName: Full=CDP-abequose synthase; EC=4.2.1.-;AltName: Full=O4 antigen; SW:GN Name=rfbJ; OrderedLocusNames=STM2089; SW:KW Complete proteome; Lipopolysaccharide biosynthesis; Lyase; NAD. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->299|RFBJ_SALTY|e-175|100.0|299/299| GO:SWS:NREP 2 GO:SWS GO:0009103|"GO:lipopolysaccharide biosynthetic process"|Lipopolysaccharide biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 9->297|2pk3A|1e-17|27.9|280/309| RP:PDB:NREP 1 RP:PDB:REP 8->297|2b69A|1e-22|16.5|279/302| RP:PFM:NREP 1 RP:PFM:REP 8->216|PF01370|4e-17|34.8|201/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 8->229|PF01370|1.5e-42|29.9|214/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 8->294|1sb8A|2e-30|22.4|286/341|c.2.1.2| HM:SCP:REP 7->300|1eq2A_|5.3e-42|27.1|280/307|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 447 OP:NHOMOORG 338 OP:PATTERN --------11111111--------1112-2--11211212121--1-112-1111111111------- --1---1-----------------------------1--2-----1---------------------11-------------1-23213211-111----2-11111311-----------------111211222---1----1-11--221----------1------11--1----1-1---1---11-11-----2212-21212-41121--311-2---------21111111111111111-----1-----------2-----1----1---------------------------------------------111-3-3332222121--22------2--1--1--1-1-11-1----11---4--11-------1-----------1---1-111-----1----1---------2---1--1-111---1111-----------------1---------------------------------------------------------------------------------1-------------------------------1--12----12----2------112211---11-------------1-1--11--2---1-1-1-------1111--11-------1--1-------11--1-------------------------------------121-11111111-1111---------1-111111111111---------1111----1------------------------11------------------1111--1111--12------1--------------------1--3223---1--1-----------------------------11111-1-----1 ----1------1321------------------------------------1-----------------1----1------11-1----------------------13-1-----2111-11112-1-111-111-1--1--1111---1--1-1111---11-1--122111-5---61-1--2--7-4-3-12322 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 299 STR:RPRED 100.0 SQ:SECSTR HHHGcEEEEEETTTcHHHHHHHHHHTTcEEEEEEccccccccGGGTGGGTTcTTEEEEEccTTccccccccEEEEccccccHHHHTcHHHHHHHHHHHHHHHHHHHHHTcEEEEEEEGGGGcccccccccTTcccccccTTHHHHHHHHHHHcccEEEEEEccEEcTTcTcccHHHHHHHHHHHTccEEEEcccccEEEcEEHHHHHHHHHHHTccccccTTcccEEEccccEEEHHHHHHHHHHHHTccccEEEEEEEEcccTTcccccccccHHHHHHcccccccHHHHHHHHHHcH DISOP:02AL 1-3| PSIPRED ccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccccHHccccccccccHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHccccEEEccccccEEEEEEHHHHHHHHHHHHHcccccccccEEEccccccEEHHHHHHHHHHHHcccccccEEEccccccccccccccccHHHHHHccccccccHHHHHHHHHHHc //