[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69725.1
DDBJ      :             antitermination protein Q
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->50 PF03589 * Antiterm 1e-10 52.1 %
:HMM:PFM   2->50 PF03589 * Antiterm 3.1e-15 36.7 49/95  
:BLT:SWISS 1->53 REGQ_LAMBD 8e-27 98.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69725.1 GT:GENE ACF69725.1 GT:PRODUCT antitermination protein Q GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 392518..392679 GB:FROM 392518 GB:TO 392679 GB:DIRECTION + GB:PRODUCT antitermination protein Q GB:PROTEIN_ID ACF69725.1 GB:DB_XREF GI:194409506 LENGTH 53 SQ:AASEQ MPASAAYRAITMLIPNLTQPTWSRTVKPLYDALVVQCHKEESIADNILNAVTR GT:EXON 1|1-53:0| BL:SWS:NREP 1 BL:SWS:REP 1->53|REGQ_LAMBD|8e-27|98.1|53/207| RP:PFM:NREP 1 RP:PFM:REP 3->50|PF03589|1e-10|52.1|48/90|Antiterm| HM:PFM:NREP 1 HM:PFM:REP 2->50|PF03589|3.1e-15|36.7|49/95|Antiterm| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF03589|IPR003222| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03589|IPR003222| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------1-1----1----1--111-11-----------1----1-----1-------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------1---------------------------------------------111----------------------------- DISOP:02AL 1-5,53-54| PSIPRED cccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHc //