[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69730.1
DDBJ      :             rare lipoprotein A
Swiss-Prot:RLPA_SALTY   RecName: Full=Rare lipoprotein A;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  489/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.52.1d.58.52
:377 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   86->176 3d30A PDBj 2e-10 16.5 %
:RPS:SCOP  67->173 1n10A2  b.52.1.3 * 1e-12 15.2 %
:RPS:SCOP  305->376 1utaA  d.58.52.1 * 6e-08 18.3 %
:HMM:SCOP  63->173 1bw3A_ b.52.1.2 * 1.1e-05 19.4 %
:HMM:SCOP  301->374 1utaA_ d.58.52.1 * 1.3e-12 29.2 %
:RPS:PFM   82->158 PF03330 * DPBB_1 4e-05 42.4 %
:HMM:PFM   81->168 PF03330 * DPBB_1 2.2e-17 38.7 75/78  
:HMM:PFM   303->373 PF05036 * SPOR 3.2e-17 30.0 70/76  
:BLT:SWISS 1->377 RLPA_SALTY e-162 99.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69730.1 GT:GENE ACF69730.1 GT:PRODUCT rare lipoprotein A GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(748180..749313) GB:FROM 748180 GB:TO 749313 GB:DIRECTION - GB:PRODUCT rare lipoprotein A GB:NOTE identified by match to protein family HMM PF03330; match to protein family HMM PF05036; match to protein family HMM TIGR00413 GB:PROTEIN_ID ACF69730.1 GB:DB_XREF GI:194409511 LENGTH 377 SQ:AASEQ MRKQLPVICVAAGIVLLAACTNDGGQQQTTVAPQPAVCNGPTVEISGAEPRYEPLNPTANQDYQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYARITNLANGRMIVVRINDRGPYGTDRVISLSRAAADRLNTSNNTKVRIDPIIVAPDGSLSGPGMACTTVAKQTYALPPRPDLSGGMGSASSAPAQPQGDVLPVSNSTLKSDDTTGAPVSSSGFLGAPTTLAPGVLESNEPTPTPQTAPVSAPVTAPATATPVSAPAAAAPVSAPVSAPAAAASARFVVQVGAVSDQTRAQQYQQRLSQQFSVPGRVIQNGAVWRIQLGPFASKAEASALQQRLQTEAQLQSFIASAQ GT:EXON 1|1-377:0| SW:ID RLPA_SALTY SW:DE RecName: Full=Rare lipoprotein A;Flags: Precursor; SW:GN Name=rlpA; OrderedLocusNames=STM0638; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->377|RLPA_SALTY|e-162|99.7|377/381| GO:SWS:NREP 2 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| SEG 203->218|sggmgsassapaqpqg| SEG 260->304|ptptpqtapvsapvtapatatpvsapaaaapvsapvsapaaaasa| SEG 316->329|qtraqqyqqrlsqq| RP:PDB:NREP 1 RP:PDB:REP 86->176|3d30A|2e-10|16.5|85/208| RP:PFM:NREP 1 RP:PFM:REP 82->158|PF03330|4e-05|42.4|66/80|DPBB_1| HM:PFM:NREP 2 HM:PFM:REP 81->168|PF03330|2.2e-17|38.7|75/78|DPBB_1| HM:PFM:REP 303->373|PF05036|3.2e-17|30.0|70/76|SPOR| RP:SCP:NREP 2 RP:SCP:REP 67->173|1n10A2|1e-12|15.2|105/133|b.52.1.3| RP:SCP:REP 305->376|1utaA|6e-08|18.3|71/77|d.58.52.1| HM:SCP:REP 63->173|1bw3A_|1.1e-05|19.4|108/125|b.52.1.2|1/1|Barwin-like endoglucanases| HM:SCP:REP 301->374|1utaA_|1.3e-12|29.2|72/0|d.58.52.1|1/1|Sporulation related repeat| OP:NHOMO 645 OP:NHOMOORG 491 OP:PATTERN -------------------------------------------------------------------- 221---------------------------------------------------------1--2------1-----------21---------1-----112---1111----------------22232223212----------211111111112221112111--11-1-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1---111111111123331222322222222222222-32443323221122221121112222111----------222222222222112211--------1111111111111111111-1-131111111111111111111331111111111112--111131--121-2-1111111111111111111211-1211112212222-111-11-1111111--1111111111111111111111111-22222111121221222212122221111211--11111------11111111111111111-112111111111111111111111111111111111111111111111111--111111111111---1111112222111221111111111-111111111111121122222222222222221----------1111111112121111111111111111--1-111111111-1---11--------------------------------------2 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 24.1 SQ:SECSTR #####################################################################################ccccccTTccEEEcHHHHTGGGcTTTTTHHHcGGTcEEEEEETTEEEEEEEEEEcTTccTTcEEEcHHHHHHHccGGGccEEEEEEEEccc######################################################################################################################################################################################################### DISOP:02AL 1-1,21-61,174-305,313-333| PSIPRED cccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEccEEEEEcccccccEEEEEEEEEccccccccccccccccccHHHHHccccccccEEEEEEcccccEEEEEEcccccccccEEEEccHHHHHHHcccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEc //