[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69752.1
DDBJ      :             general negative regulator of transcription subunit 1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  154/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->90 PF07023 * DUF1315 3e-30 68.2 %
:HMM:PFM   4->82 PF07023 * DUF1315 1.8e-39 51.9 79/94  
:BLT:SWISS 1->90 YEAC_ECOLI 2e-42 87.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69752.1 GT:GENE ACF69752.1 GT:PRODUCT general negative regulator of transcription subunit 1 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1375530..1375808 GB:FROM 1375530 GB:TO 1375808 GB:DIRECTION + GB:PRODUCT general negative regulator of transcription subunit 1 GB:NOTE identified by match to protein family HMM PF07023 GB:PROTEIN_ID ACF69752.1 GB:DB_XREF GI:194409533 LENGTH 92 SQ:AASEQ MNLDEIINSMTPEVYQRLSTAVELGKWPDGVALTPEQKENSLQLVMLWQARHNTEAQHMTIDTHGQMVMKSKQQLKADFGITSKPIATLKMQ GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 1->90|YEAC_ECOLI|2e-42|87.8|90/90| RP:PFM:NREP 1 RP:PFM:REP 3->90|PF07023|3e-30|68.2|88/88|DUF1315| HM:PFM:NREP 1 HM:PFM:REP 4->82|PF07023|1.8e-39|51.9|79/94|DUF1315| OP:NHOMO 154 OP:NHOMOORG 154 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11-111111111111111111111111-------------11111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111---1-----------1-1---------------11111111111111111111111111111----------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccHHHcEEEccccEEHHHHHHHHHHHHcccHHHHEEEEcc //