[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69761.1
DDBJ      :             PTS system sorbose subfamily IIB component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  206/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.38.1
:156 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->144 1vsqC PDBj 3e-19 32.6 %
:RPS:PDB   2->156 1bleA PDBj 4e-35 28.4 %
:RPS:SCOP  2->156 1bleA  c.38.1.1 * 3e-35 28.4 %
:HMM:SCOP  1->156 1nrzA_ c.38.1.1 * 1.3e-40 37.8 %
:RPS:PFM   1->150 PF03830 * PTSIIB_sorb 1e-23 36.7 %
:HMM:PFM   1->149 PF03830 * PTSIIB_sorb 5.3e-48 38.9 149/151  
:BLT:SWISS 1->144 PTNAB_SHIFL 8e-19 32.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69761.1 GT:GENE ACF69761.1 GT:PRODUCT PTS system sorbose subfamily IIB component GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(684361..684831) GB:FROM 684361 GB:TO 684831 GB:DIRECTION - GB:PRODUCT PTS system sorbose subfamily IIB component GB:NOTE identified by match to protein family HMM PF03830 GB:PROTEIN_ID ACF69761.1 GB:DB_XREF GI:194409542 LENGTH 156 SQ:AASEQ MIKLVRIDYRLLHGQVVFAWTRALDIDHIIVANANAAGDAFVSMSLSLAKPAGVSLDIITVEQAAEKLASGKLDHKKVMVVLGNTAETLAFVEKVPGISVINYGGIAQKEGAQQFGKAIYLTEQEIADSQALKAKGIRLEMRQVPAHSAELLNDKL GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 1->144|PTNAB_SHIFL|8e-19|32.6|144/323| BL:PDB:NREP 1 BL:PDB:REP 1->144|1vsqC|3e-19|32.6|144/165| RP:PDB:NREP 1 RP:PDB:REP 2->156|1bleA|4e-35|28.4|155/161| RP:PFM:NREP 1 RP:PFM:REP 1->150|PF03830|1e-23|36.7|150/151|PTSIIB_sorb| HM:PFM:NREP 1 HM:PFM:REP 1->149|PF03830|5.3e-48|38.9|149/151|PTSIIB_sorb| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF03830|IPR004720| GO:PFM GO:0008982|"GO:protein-N(PI)-phosphohistidine-sugar phosphotransferase activity"|PF03830|IPR004720| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF03830|IPR004720| RP:SCP:NREP 1 RP:SCP:REP 2->156|1bleA|3e-35|28.4|155/161|c.38.1.1| HM:SCP:REP 1->156|1nrzA_|1.3e-40|37.8|156/163|c.38.1.1|1/1|PTS IIb component| OP:NHOMO 464 OP:NHOMOORG 206 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------1----------1-------1-11-1-------1--434444----------------------B1-1391131433--6414411211122233332223332232333322222222212222221112222---18-------3-2-6---431---2-3----------------1-1121-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111---------1-----1-1----------------------------1---------------------1----1--1------------311123-3444354543-3233444443454333333433122212321222331213112221133211-211111111111111---------------2222121----2111---------------------------------------------------11-----------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 100.0 SQ:SECSTR EEEEEEEETTcccTTHHHHHHHHHTccEEEEEcHHHHHcHHHHHHHHTcccTTcEEEEEcHHHHHHHHHccTTTTcEEEEEEcccHHHHHHHTTTccccEEEEEEccccTTcEEcccccEEcHHHHHHHHHHHHTTcEEEEcccTTcccEEHHHHH PSIPRED cEEEEEEccccEEEEEEEEEEccccccEEEEEEHHHHccHHHHHHHHHccccccEEEEEEHHHHHHHHcccccccEEEEEEEccHHHHHHHHHccccccEEEEcccccccccEEEEcEEEccHHHHHHHHHHHHcccEEEEEEccccccccHHHcc //