[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69765.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->39 1tnsA PDBj 2e-04 41.0 %
:RPS:SCOP  1->45 1g4dA  a.6.1.7 * 1e-05 31.1 %
:HMM:SCOP  1->60 1g4dA_ a.6.1.7 * 9.7e-10 40.0 %
:RPS:PFM   1->114 PF07037 * DUF1323 5e-36 71.7 %
:HMM:PFM   1->114 PF07037 * DUF1323 3.3e-53 63.7 113/122  
:BLT:SWISS 1->115 YFEC_SHIFL 3e-46 78.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69765.1 GT:GENE ACF69765.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2587171..2587518 GB:FROM 2587171 GB:TO 2587518 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF07037 GB:PROTEIN_ID ACF69765.1 GB:DB_XREF GI:194409546 LENGTH 115 SQ:AASEQ MTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKARLVHVNEQVREYIRSAERSVDHHADTFTPASNASLEALLMTLAKEMTSSEQKQFTSLLVREGITGLLQRLGIRDSK GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 1->115|YFEC_SHIFL|3e-46|78.9|114/114| BL:PDB:NREP 1 BL:PDB:REP 1->39|1tnsA|2e-04|41.0|39/76| RP:PFM:NREP 1 RP:PFM:REP 1->114|PF07037|5e-36|71.7|113/116|DUF1323| HM:PFM:NREP 1 HM:PFM:REP 1->114|PF07037|3.3e-53|63.7|113/122|DUF1323| RP:SCP:NREP 1 RP:SCP:REP 1->45|1g4dA|1e-05|31.1|45/69|a.6.1.7| HM:SCP:REP 1->60|1g4dA_|9.7e-10|40.0|60/69|a.6.1.7|1/1|Putative DNA-binding domain| OP:NHOMO 117 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22---212222222222-2222222222222222222222-----2222222222222222-2222222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 83 STR:RPRED 72.2 SQ:SECSTR ccHHHHHHHHTccHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHH################################ DISOP:02AL 1-1,113-116| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccc //