[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69769.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YEJL_SALTY   RecName: Full=UPF0352 protein yejL;

Homologs  Archaea  0/68 : Bacteria  81/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.284.1
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->75 2jrxA PDBj 2e-24 70.7 %
:RPS:SCOP  28->69 2otaA1  a.284.1.1 * 1e-04 41.5 %
:RPS:PFM   28->69 PF07208 * DUF1414 1e-12 90.5 %
:HMM:PFM   26->69 PF07208 * DUF1414 4.7e-28 70.5 44/44  
:BLT:SWISS 1->75 YEJL_SALTY 2e-25 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69769.1 GT:GENE ACF69769.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2376248..2376475 GB:FROM 2376248 GB:TO 2376475 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF07208 GB:PROTEIN_ID ACF69769.1 GB:DB_XREF GI:194409550 LENGTH 75 SQ:AASEQ MPQLSRYSDEHVEQLLSELLSVLEKHKAPTDLSLMVLGNMVTNLINTSVAPAQRQAIANSFARALQSSISEDNAH GT:EXON 1|1-75:0| SW:ID YEJL_SALTY SW:DE RecName: Full=UPF0352 protein yejL; SW:GN Name=yejL; OrderedLocusNames=STM2227; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->75|YEJL_SALTY|2e-25|100.0|75/75| SEG 10->27|ehveqllsellsvlekhk| BL:PDB:NREP 1 BL:PDB:REP 1->75|2jrxA|2e-24|70.7|75/83| RP:PFM:NREP 1 RP:PFM:REP 28->69|PF07208|1e-12|90.5|42/44|DUF1414| HM:PFM:NREP 1 HM:PFM:REP 26->69|PF07208|4.7e-28|70.5|44/44|DUF1414| RP:SCP:NREP 1 RP:SCP:REP 28->69|2otaA1|1e-04|41.5|41/62|a.284.1.1| OP:NHOMO 81 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------------------------11111111111111-11-111111111111111111111111111111111111111111111111111--111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 100.0 SQ:SECSTR cccTTcTTHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHccTTcHHHHHHHHHHHHHHHccccccc DISOP:02AL 1-4,67-68,70-76| PSIPRED ccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccc //