[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69774.1
DDBJ      :             protein YcfR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.230.6
:85 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->85 2nocA PDBj 6e-06 43.1 %
:RPS:SCOP  27->85 2nocA1  d.230.6.1 * 1e-15 37.3 %
:RPS:PFM   34->85 PF07338 * DUF1471 5e-05 58.0 %
:HMM:PFM   27->85 PF07338 * DUF1471 2.2e-22 47.4 57/65  
:BLT:SWISS 1->85 BHSA_ECOLI 1e-30 75.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69774.1 GT:GENE ACF69774.1 GT:PRODUCT protein YcfR GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1301768..1302025 GB:FROM 1301768 GB:TO 1302025 GB:DIRECTION + GB:PRODUCT protein YcfR GB:NOTE identified by match to protein family HMM PF07338 GB:PROTEIN_ID ACF69774.1 GB:DB_XREF GI:194409555 LENGTH 85 SQ:AASEQ MKNVKTLIAAAVLSSLSFASFAAVEVQATPEGQQKFGTISANGGTNLGSLEDQLAQKAQEMGAKSFRITSVTGPNTLHGTAVIYK GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 1->85|BHSA_ECOLI|1e-30|75.3|85/85| TM:NTM 1 TM:REGION 5->26| SEG 9->24|aaavlsslsfasfaav| BL:PDB:NREP 1 BL:PDB:REP 35->85|2nocA|6e-06|43.1|51/99| RP:PFM:NREP 1 RP:PFM:REP 34->85|PF07338|5e-05|58.0|50/64|DUF1471| HM:PFM:NREP 1 HM:PFM:REP 27->85|PF07338|2.2e-22|47.4|57/65|DUF1471| RP:SCP:NREP 1 RP:SCP:REP 27->85|2nocA1|1e-15|37.3|59/91|d.230.6.1| OP:NHOMO 94 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211--1-2222222222-2222222222222222221111-----1111111111111111-1122222--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 60.0 SQ:SECSTR ##################################EEEEEEccccccHHHHHHHHHHHHHHTcccEEEccccccccccccEEEEEE DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHccccEEEEEEcccccccccccEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEEEEc //