[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69775.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  200/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   105->185 2katA PDBj 9e-05 37.8 %
:HMM:PFM   10->50 PF09976 * DUF2133 1.7e-18 31.7 41/43  
:HMM:PFM   49->156 PF00529 * HlyD 8.9e-05 23.4 94/306  
:BLT:SWISS 1->206 YFGM_ECOLI 2e-93 89.8 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69775.1 GT:GENE ACF69775.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2710916..2711536) GB:FROM 2710916 GB:TO 2711536 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69775.1 GB:DB_XREF GI:194409556 LENGTH 206 SQ:AASEQ MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSHQTESARAASLAYQNAVTAVSADKPDSIPAAEKFAAENKNTYGALASMELAQQFVDKNELKKAEAQLQQGLAATSDENLKAVINLRLARVQLQLKQADAALKTLDAVKGEGWTAIVADLRGEALLSKGDKKGARSAWEAGVNSDASPALSEMMQMKINNLSI GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 1->206|YFGM_ECOLI|2e-93|89.8|206/206| COIL:NAA 7 COIL:NSEG 1 COIL:REGION 125->131| SEG 24->38|alavgvilgvgalvg| BL:PDB:NREP 1 BL:PDB:REP 105->185|2katA|9e-05|37.8|74/115| HM:PFM:NREP 2 HM:PFM:REP 10->50|PF09976|1.7e-18|31.7|41/43|DUF2133| HM:PFM:REP 49->156|PF00529|8.9e-05|23.4|94/306|HlyD| OP:NHOMO 200 OP:NHOMOORG 200 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1------1----11-1---------1-11----1--------1-----1-1--1--------11--1-----------------------------------------------------------1-11-1111111111111111111111111---1---1--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111----111111-1------1-----111111-111111111111111-1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 35.9 SQ:SECSTR ########################################################################################################HHHHHHHTTTc#####ccH##HHHHHHHHHHHHTTcHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHTcHHHHHHHHHHHH##################### DISOP:02AL 65-72,188-192,194-194| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcc //