[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69778.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  396/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:256 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   9->215 PF01061 * ABC2_membrane 5e-12 28.1 %
:HMM:PFM   9->219 PF01061 * ABC2_membrane 1.4e-38 27.5 204/208  
:BLT:SWISS 1->256 YADH_SHIFL e-123 89.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69778.1 GT:GENE ACF69778.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 203522..204292 GB:FROM 203522 GB:TO 204292 GB:DIRECTION + GB:PRODUCT ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF01061 GB:PROTEIN_ID ACF69778.1 GB:DB_XREF GI:194409559 LENGTH 256 SQ:AASEQ MMQLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNLIGSRIGEMHGFSYMQFIVPGLIMMAVITNSYANVASSFFSAKFQRNIEELLVAPVPTHVIIAGFVGGGVARGLCVGILVTAISLFFVPFQVHSWVFVALTLILTAILFSLAGLLNAVFAKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIHDVPLVTTFGVLVIFIAAFYLLCWSLIQRGRGLRS GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 1->256|YADH_SHIFL|e-123|89.8|256/256| TM:NTM 6 TM:REGION 24->46| TM:REGION 55->77| TM:REGION 102->124| TM:REGION 141->163| TM:REGION 171->193| TM:REGION 224->246| SEG 104->117|viiagfvgggvarg| RP:PFM:NREP 1 RP:PFM:REP 9->215|PF01061|5e-12|28.1|199/208|ABC2_membrane| HM:PFM:NREP 1 HM:PFM:REP 9->219|PF01061|1.4e-38|27.5|204/208|ABC2_membrane| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF01061|IPR013525| OP:NHOMO 531 OP:NHOMOORG 427 OP:PATTERN ---1------------1-------1--11--1--11--1111123-1221212-111-11----1--- --1-1----------------------------------------------------------------------------121--------------------------------------------1------------1111------------------2------------------------1------------------------------------111111----------------------1---------------------------------------------1------------------------11--------------11------------11----1--2-1--------3-2222------111111111111------------11111111122-111121221122111122121-11122-------------111-----------------------------221121222223222232222222332222223232121-211122111111111231111111-------11122121-------------111-1111211111--1-------------------------22111122211111111111111111111111---1111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--11111111111121211111-11----11111111111111211111111121111211111111111111111111111111111222222221111111-222222-----------------------------------------1-111--1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,255-257| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //