[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69806.1
DDBJ      :             invasion protein
Swiss-Prot:INVF_SALTY   RecName: Full=Invasion protein invF;AltName: Full=Transcriptional regulator invF;

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   150->238 1bl0A PDBj 4e-11 21.3 %
:RPS:SCOP  150->238 1v4aA1  a.24.16.4 * 2e-10 12.4 %
:HMM:SCOP  194->242 1d5yA2 a.4.1.8 * 1.6e-05 30.6 %
:HMM:PFM   157->189 PF00165 * HTH_AraC 4.2e-06 21.2 33/42  
:HMM:PFM   196->222 PF07875 * Coat_F 2.1e-05 25.9 27/64  
:BLT:SWISS 34->249 INVF_SALTY e-124 100.0 %
:PROS 195->237|PS00041|HTH_ARAC_FAMILY_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69806.1 GT:GENE ACF69806.1 GT:PRODUCT invasion protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(3017796..3018545) GB:FROM 3017796 GB:TO 3018545 GB:DIRECTION - GB:PRODUCT invasion protein GB:NOTE identified by match to protein family HMM PF00165 GB:PROTEIN_ID ACF69806.1 GB:DB_XREF GI:194409587 LENGTH 249 SQ:AASEQ MLNTQEVLKEGEKRKIRSPEAWFIQTCSAQKLHMSFSESRHNENCLIQEGALLFCEQAVVAPVSGDLVFRPLKIEVLSKLLAFIDGAGLVDTTYAESDKWVLLSPEFRAIWQDRKRCEYWFLQQIITPSPAFNKVLALLRKSESYWLVGYLLAQSTSGNTMRMLGEDYGVSYTHFRRLCSRALGGKAKSELRNWRMAQSLLNSVEGHENITQLAVNHGYSSPSHFSSEIKELIGVSPRKLSNIIQLADK GT:EXON 1|1-249:0| SW:ID INVF_SALTY SW:DE RecName: Full=Invasion protein invF;AltName: Full=Transcriptional regulator invF; SW:GN Name=invF; OrderedLocusNames=STM2899; SW:KW Activator; Complete proteome; DNA-binding; Transcription;Transcription regulation; Virulence. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 34->249|INVF_SALTY|e-124|100.0|216/216| GO:SWS:NREP 4 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| PROS 195->237|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| RP:PDB:NREP 1 RP:PDB:REP 150->238|1bl0A|4e-11|21.3|89/116| HM:PFM:NREP 2 HM:PFM:REP 157->189|PF00165|4.2e-06|21.2|33/42|HTH_AraC| HM:PFM:REP 196->222|PF07875|2.1e-05|25.9|27/64|Coat_F| RP:SCP:NREP 1 RP:SCP:REP 150->238|1v4aA1|2e-10|12.4|89/151|a.24.16.4| HM:SCP:REP 194->242|1d5yA2|1.6e-05|30.6|49/0|a.4.1.8|1/1|Homeodomain-like| OP:NHOMO 40 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----1111-1------------------------------1--------------------------------------------------------------------------------------------------------------------------1-11--------1---------1-1-------------11111111111111111--111--12-1-------------1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 63.1 SQ:SECSTR #############################################################################cccEEEEEcTTTccHHHHHHHHHHHHcccccccTTccccHHHHHHcTTGGGccccTTHHHHHHH####HHHHHHHTTTTcccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHH########### DISOP:02AL 1-3,5-5,7-7,9-9,11-12,14-14,247-250| PSIPRED cccHHHHHccccEEEcccccEEEEEcccccEEEEEEccccccEEEEEcccHHHHHHHHHcccccccHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHcc //