[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69825.1
DDBJ      :             ABC nickel/di-oligopepetide transporter, permease subunit
Swiss-Prot:             

Homologs  Archaea  48/68 : Bacteria  613/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:270 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  37->269 2r6gG1  f.58.1.1 * 4e-20 11.3 %
:HMM:PFM   84->262 PF00528 * BPD_transp_1 7.2e-22 23.1 169/185  
:BLT:SWISS 27->246 Y207_BRUME 9e-26 34.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69825.1 GT:GENE ACF69825.1 GT:PRODUCT ABC nickel/di-oligopepetide transporter, permease subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1346762..1347574 GB:FROM 1346762 GB:TO 1347574 GB:DIRECTION + GB:PRODUCT ABC nickel/di-oligopepetide transporter, permease subunit GB:NOTE identified by match to protein family HMM PF00528 GB:PROTEIN_ID ACF69825.1 GB:DB_XREF GI:194409606 LENGTH 270 SQ:AASEQ MLYNPAPTLFRLILSVTCLLFIAGYGYATLSQPPEVNLLARHLSPDIQHWFGTDNLGRDVWLRCFQGAFTSLQIGVGAALCSGVIALVMAAAARIHPRLDLLMRLITDAMLAMPHLLLLILICFTLGGGKSGVIAAVALTHWPRLALILRADAERVAQSDYLTLTYRLGHGHLYCWRYHYFPALLPQWLTGTLLMFPHAVLHSAALSFLGFGLAPHEPSLGLLLADALRFISHGNWWLVLFPGLMLFTLVMLFDQFARAIQRLWLRSDVC GT:EXON 1|1-270:0| BL:SWS:NREP 1 BL:SWS:REP 27->246|Y207_BRUME|9e-26|34.7|219/296| TM:NTM 6 TM:REGION 7->28| TM:REGION 71->93| TM:REGION 103->125| TM:REGION 129->151| TM:REGION 189->211| TM:REGION 237->259| SEG 116->122|llllili| HM:PFM:NREP 1 HM:PFM:REP 84->262|PF00528|7.2e-22|23.1|169/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 37->269|2r6gG1|4e-20|11.3|230/284|f.58.1.1| OP:NHOMO 2146 OP:NHOMOORG 664 OP:PATTERN 11213-1-222222111211221132233-3112---1-------2-42-963-2312112---3-11 -1-3624-122-21-------3--18-----12222153513-23542111-24111---3213412344-----1--223-2-------------2--------11--111111111111111111111111121244422214911--1111122------1--13-1---11-----11-7211-43-323666664564546444A66653654224A411222222E4122222232322223122211-1-33---------3311111111233332221--1221111111222222222222223--111---1-B242333233312212221---33-239-111A933---72-212-16311-----11--12-BBF--45315-7788778688G-22321216HE--TNNMDC5MMEHGF3-113498588498--------11111-17----------------------------------1AB98A3555533333344573333-4457539711223-351133938G14--22241----------1--333-21252233331111111111------11--11-11-11112212221112-1111332-11-1--3-------1----1-11-1---111-1------34G92434444444444-4444444444444444443676A81143333333333333333445334241-222222221222--------------1527222--12111-3111------2-11-11-1111-22322226661----1---144436666644443------------------111111-11-----3-1--1--------1----------111-32327A756-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-----------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHccccccccHHcccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //