[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69854.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->65 PF10953 * DUF2754 4e-27 87.7 %
:HMM:PFM   1->65 PF10953 * DUF2754 1.9e-45 80.0 65/70  
:BLT:SWISS 1->71 YAIZ_ECOLI 1e-32 85.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69854.1 GT:GENE ACF69854.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 480437..480652 GB:FROM 480437 GB:TO 480652 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69854.1 GB:DB_XREF GI:194409635 LENGTH 71 SQ:AASEQ MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGLVTWIISFWLAGFIIRRREDDEVKDAR GT:EXON 1|1-71:0| BL:SWS:NREP 1 BL:SWS:REP 1->71|YAIZ_ECOLI|1e-32|85.7|70/70| TM:NTM 2 TM:REGION 14->34| TM:REGION 42->59| RP:PFM:NREP 1 RP:PFM:REP 1->65|PF10953|4e-27|87.7|65/70|DUF2754| HM:PFM:NREP 1 HM:PFM:REP 1->65|PF10953|1.9e-45|80.0|65/70|DUF2754| OP:NHOMO 58 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-1111111111-1111111111111111111111-----1111111111111111-1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,63-72| PSIPRED ccccEEEEccccHHHHHHHHHHHHHHHHHHHcccccccEEEcHHHHHHHHHHHHHHHHHccccHHHHHHcc //