[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69872.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:323 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 222->284 GUF1_YEAST 1e-04 30.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69872.1 GT:GENE ACF69872.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(183689..184660) GB:FROM 183689 GB:TO 184660 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69872.1 GB:DB_XREF GI:194409653 LENGTH 323 SQ:AASEQ MTYFKWLSVLLCFITSYHAYANDSAVGETNGSIEFLQQNEISMAKERLLIASDRINVDYVFINHSAQDITVPVAFPMPAISQQYMGDRTEGIANFKISVDGKPVKSESRWRVIHDLGGKGEEDITAKLLQTGWTIPQLRHVLNREGKASIEEGYKEGKQQLPSEWFDDGYLNIAVQQYFIWQQRFPAGKEIVIHHSYTPSTSTGVPDSLDSLLGDELGDQCLTAATRKALKQLDAGIKYKNEDGSANIGWGYLGYILKTGANWKEGVIGDFTLRIHKKDETEVVVPCFNYPLKQIDPLTLEFKQKNFKPDENLDIHFYYDSSL GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 222->284|GUF1_YEAST|1e-04|30.2|63/100| SEG 207->219|dsldsllgdelgd| OP:NHOMO 27 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---1-------------------111---------111--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-1--1--------------------------------------------------------------------22--------------------------------------------------1-----------------------------------------------------------------1111111---------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHcccccccccEEEEcccEEEEEEcccHHHHHHccccccEEEEEEEEEEEcccccEEEEEEccccccccccccccccccccEEEEEccEEcccccccEEEEEcccccccHHHHHHHHccccHHHHHHHHHHccHHHHHHHcccccccccHHHHcccccEEEEEEEEEEEEccccccEEEEEEEEEccccccccccHHHHHHHccccEEccHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEccccccccccEEEEEEEccccccEEEEcccccEEEEcccEEEEEEccccccccEEEEEEEEccc //