[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69885.1
DDBJ      :             ABC superfamily
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  131/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:318 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->302 2chuB PDBj 2e-08 22.1 %
:RPS:PDB   30->318 3be6A PDBj 2e-37 19.0 %
:RPS:SCOP  24->316 2chuA1  c.92.2.4 * 4e-32 21.1 %
:HMM:SCOP  43->318 1efdN_ c.92.2.1 * 4.8e-45 32.2 %
:RPS:PFM   49->295 PF01497 * Peripla_BP_2 4e-18 38.9 %
:HMM:PFM   49->297 PF01497 * Peripla_BP_2 9.5e-32 24.7 231/238  
:BLT:SWISS 1->318 FEPB_ECOLI e-132 78.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69885.1 GT:GENE ACF69885.1 GT:PRODUCT ABC superfamily GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(703420..704376) GB:FROM 703420 GB:TO 704376 GB:DIRECTION - GB:PRODUCT ABC superfamily GB:NOTE identified by match to protein family HMM PF01497 GB:PROTEIN_ID ACF69885.1 GB:DB_XREF GI:194409666 LENGTH 318 SQ:AASEQ MRLPAFYRWLLLVVGLSISGISLAQDAGWPRQIQDSRGVHTLDHKPARIVSTSVTLTGSLLAIDAPVVASGATTPNNRFADDQGFMRQWSDVAKARHVARLYIGEPNAETVAAQMPDLILISATGGDSALALYDQLSAIAPTLVINYDDKSWQSLLTQLGEITGQEKQAAARIAEFEAQLTTVKQRIALPPQPVSALVYTPAAHSANLWTPESAQGKLLTQLGFTLATLPRGLQTSKSQGKRHDIIQLGGENLAAGLNGESLFLFAGDNKDVAALYANPLLAHLPAVQNKRVYALGTETFRLDYYSATLLLNRLAALF GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 1->318|FEPB_ECOLI|e-132|78.6|318/318| TM:NTM 1 TM:REGION 6->28| SEG 248->260|lggenlaaglnge| BL:PDB:NREP 1 BL:PDB:REP 26->302|2chuB|2e-08|22.1|253/283| RP:PDB:NREP 1 RP:PDB:REP 30->318|3be6A|2e-37|19.0|279/289| RP:PFM:NREP 1 RP:PFM:REP 49->295|PF01497|4e-18|38.9|221/235|Peripla_BP_2| HM:PFM:NREP 1 HM:PFM:REP 49->297|PF01497|9.5e-32|24.7|231/238|Peripla_BP_2| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 24->316|2chuA1|4e-32|21.1|265/283|c.92.2.4| HM:SCP:REP 43->318|1efdN_|4.8e-45|32.2|255/262|c.92.2.1|1/1|"Helical backbone" metal receptor| OP:NHOMO 184 OP:NHOMOORG 132 OP:PATTERN -------------------------------------------------------------------- ------1-224-1------------------------842----111----------2---1-------1-------------------------------------------------------------------11----------1--------------1---4--------------------------------------1---11--------1----------1--------------------------------------------------------------------------------------------------11-1-1-----------------------------------------------------------------------1--------------111---------------1-----------------------------------------------------------------------------------------------------1------------1--------------------------------------------------------------------------------------------------------------------2111-112111211121-123111212212222222111112211111111111111111111111112--222222222222---------------1------1---------1------------11-1-1-1--1-----------------11-11111--1--------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 92.8 SQ:SECSTR #######################EEEcccEEEEEcTTccEEEEcccccEEEccTTTHHHHHHTTccccEEccEEcTTccEEcTTHHHHHcccGGGcccEEcccccccHHHHHHTcccEEEEcTTTTTTccccHHHHHHHccEEEccTTTTHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHccccGGGccEEEEEEETTEEEEcccHHHHHHHHHHTTccccHHHHTccTTcEEEcGGGGGGGcccEEEEEEccTTEEEcccTHHHHHHHHHTTGGGGcHHHHTTcEEEEEHHHHHcccHHHHHHHHHHHHHH DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHcccccccccccEEEEEccccEEEcccccEEEEEcHHHHHHHHHcccccEEEEEcccccccccccHHHHHHccccccccccccccccccHHHHHHccccEEEEEcccccHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccEEEEcccccHHHHHHHccccccHHHcccccccccccccccccccHHHHHHHccccEEEEEcccHHHHHHHHHcHHHHccHHHHcccEEEEccccEEccHHHHHHHHHHHHHHc //