[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69894.1
DDBJ      :             sugar efflux transporter B
Swiss-Prot:SOTB_SALTI   RecName: Full=Probable sugar efflux transporter;

Homologs  Archaea  4/68 : Bacteria  450/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:396 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  4->171 1pw4A  f.38.1.1 * 9e-09 9.0 %
:HMM:SCOP  1->393 1pw4A_ f.38.1.1 * 7.7e-61 26.3 %
:RPS:PFM   39->175 PF07690 * MFS_1 7e-07 24.8 %
:HMM:PFM   18->322 PF07690 * MFS_1 1.4e-38 25.2 302/353  
:HMM:PFM   328->385 PF07690 * MFS_1 0.00018 29.3 58/353  
:BLT:SWISS 1->396 SOTB_SALTI e-179 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69894.1 GT:GENE ACF69894.1 GT:PRODUCT sugar efflux transporter B GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1646040..1647230) GB:FROM 1646040 GB:TO 1647230 GB:DIRECTION - GB:PRODUCT sugar efflux transporter B GB:NOTE identified by match to protein family HMM PF07690 GB:PROTEIN_ID ACF69894.1 GB:DB_XREF GI:194409675 LENGTH 396 SQ:AASEQ MTINPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQALSLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGALITLLCLIKLLPKLPSEHSGSLKSLPLLFRRPALMSLYVLTVVVVTAHYTAYSYIEPFVQNVAGLSANFATVLLLILGGAGIIGSLVFGKLGNRHASSLVSIAIALLVVCLLLLLPAADSEAHLAILSIFWGIAIMVIGLGMQVKVLALAPDATDVAMALFSGIFNIGIGAGALVGNQVSLHWSMSAIGYIGAIPACAALVWAVLIFRKWPVTLEEQPH GT:EXON 1|1-396:0| SW:ID SOTB_SALTI SW:DE RecName: Full=Probable sugar efflux transporter; SW:GN Name=sotB; OrderedLocusNames=STY1538, t1443; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Sugar transport; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->396|SOTB_SALTI|e-179|100.0|396/396| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 12 TM:REGION 15->37| TM:REGION 49->71| TM:REGION 80->102| TM:REGION 107->129| TM:REGION 137->159| TM:REGION 168->190| TM:REGION 210->232| TM:REGION 244->266| TM:REGION 273->295| TM:REGION 302->324| TM:REGION 333->355| TM:REGION 363->384| SEG 178->192|litllclikllpklp| SEG 213->231|slyvltvvvvtahytaysy| SEG 250->261|lllilggagiig| SEG 273->292|asslvsiaiallvvclllll| RP:PFM:NREP 1 RP:PFM:REP 39->175|PF07690|7e-07|24.8|137/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 18->322|PF07690|1.4e-38|25.2|302/353|MFS_1| HM:PFM:REP 328->385|PF07690|0.00018|29.3|58/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 4->171|1pw4A|9e-09|9.0|167/434|f.38.1.1| HM:SCP:REP 1->393|1pw4A_|7.7e-61|26.3|392/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1167 OP:NHOMOORG 458 OP:PATTERN ---------------------------------1----1----1---1-------------------- -----11122321321111-11--2311111111114833--1-32231221344-1211--1-227243-1111322-11---------21-1-------3-112---1-----------------------------1-----------------------------------------------------533333434-252245314454324--1221211111-A6111121111111111422231-3----2---1144--1-1--3111-----------------------------------------------11----------1-11-------1------12------------------711--11-14-41----1-111----------4-22111111171-43311326343342-1--3-------11111111112331--2--------------------------------2-25322369B8A83333388573334338736552--334-1311311-4232--1-131-2---------2-1-------111---11-1----------1---11---------121111111-------11121--212111--11213111--11211-------------3413-934554444444-444444444454544444289835-114244334333434343943344441-211111111111------------1---16111-11-11-1---133333241117144334768266762767--1111-1--1--1-----1-2--67332331112------11111---------------------------------------------1----- -----------------1--------------------------------------------------------------------------------------------------------------------------------------------1-----------A-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,188-203,389-389,391-397| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //