[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69904.1
DDBJ      :             putative inner membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:238 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   138->195 PF06889 * DUF1266 3e-06 39.7 %
:HMM:PFM   138->204 PF06889 * DUF1266 7.5e-09 29.9 67/234  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69904.1 GT:GENE ACF69904.1 GT:PRODUCT putative inner membrane protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2274319..2275035 GB:FROM 2274319 GB:TO 2275035 GB:DIRECTION + GB:PRODUCT putative inner membrane protein GB:PROTEIN_ID ACF69904.1 GB:DB_XREF GI:194409685 LENGTH 238 SQ:AASEQ MFWIVLIIAALFFSWRNYKKNKPLIAARIAEEKEKDRLKDLRRDTRRRQWALALADILARRNGLPIKGVELVFKLDDDKRRYLAQQVKKELGLSENLDGAALRHKVEDILRRWPAGIGSSPRTFYHHLAAQGQVRDALAFDCMRTAFLTRCIAGLGWCNENEAWLVLLLNAQRAQDCFDSWEDYATAYVRARRVWLTLRDTPTALAGRDLQEATHYLQDPVSRWRQLPWNEFKIFEPI GT:EXON 1|1-238:0| SEG 31->48|eekekdrlkdlrrdtrrr| RP:PFM:NREP 1 RP:PFM:REP 138->195|PF06889|3e-06|39.7|58/170|DUF1266| HM:PFM:NREP 1 HM:PFM:REP 138->204|PF06889|7.5e-09|29.9|67/234|DUF1266| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----------------1----------------1-------------------------------------------------------------------------------------------------------------------------------------------1-111---------1----1---------------1--1111-1-111111------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 35-41| PSIPRED cHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccHHHHHHHHHHHccHHHHHHcccHHHcccccc //