[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69930.1
DDBJ      :             transposase for
Swiss-Prot:T200_SALTY   RecName: Full=Transposase for insertion sequence element IS200;

Homologs  Archaea  19/68 : Bacteria  173/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.57
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->129 2ec2F PDBj 1e-21 37.1 %
:RPS:PDB   5->151 2a6oA PDBj 1e-35 29.0 %
:RPS:SCOP  5->129 2a6mA1  d.58.57.1 * 9e-33 35.0 %
:HMM:SCOP  1->131 2a6oA1 d.58.57.1 * 2.2e-43 44.2 %
:RPS:PFM   16->126 PF01797 * Transposase_17 8e-23 49.5 %
:HMM:PFM   12->129 PF01797 * Transposase_17 3.3e-41 40.7 118/121  
:BLT:SWISS 1->152 T200_SALTY 3e-91 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69930.1 GT:GENE ACF69930.1 GT:PRODUCT transposase for GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1029718..1030176 GB:FROM 1029718 GB:TO 1030176 GB:DIRECTION + GB:PRODUCT transposase for GB:NOTE identified by match to protein family HMM PF01797 GB:PROTEIN_ID ACF69930.1 GB:DB_XREF GI:194409711 LENGTH 152 SQ:AASEQ MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLCEWKNVRILEAECCADHIHMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSPFTGRK GT:EXON 1|1-152:0| SW:ID T200_SALTY SW:DE RecName: Full=Transposase for insertion sequence element IS200; SW:GN Name=tnpA1; OrderedLocusNames=STM0946;andName=tnpA2; OrderedLocusNames=STM1957;andName=tnpA3; OrderedLocusNames=STM2471;andName=tnpA4; OrderedLocusNames=STM3032;andName=tnpA5; OrderedLocusNames=STM3479;andName=tnpA6; OrderedLocusNames=STM4311; SW:KW Complete proteome; DNA recombination; DNA-binding;Transposable element; Transposition. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->152|T200_SALTY|3e-91|100.0|152/152| GO:SWS:NREP 3 GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0032196|"GO:transposition"|Transposition| BL:PDB:NREP 1 BL:PDB:REP 5->129|2ec2F|1e-21|37.1|124/129| RP:PDB:NREP 1 RP:PDB:REP 5->151|2a6oA|1e-35|29.0|145/152| RP:PFM:NREP 1 RP:PFM:REP 16->126|PF01797|8e-23|49.5|111/119|Transposase_17| HM:PFM:NREP 1 HM:PFM:REP 12->129|PF01797|3.3e-41|40.7|118/121|Transposase_17| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01797|IPR002686| GO:PFM GO:0004803|"GO:transposase activity"|PF01797|IPR002686| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF01797|IPR002686| RP:SCP:NREP 1 RP:SCP:REP 5->129|2a6mA1|9e-33|35.0|123/130|d.58.57.1| HM:SCP:REP 1->131|2a6oA1|2.2e-43|44.2|129/0|d.58.57.1|1/1|Transposase IS200-like| OP:NHOMO 1130 OP:NHOMOORG 193 OP:PATTERN --1---1--111--17--------1221--81-------------------BC-----1-1-12---- ---------------------2----------1------1--33----------------------11--2----------1-----1--------4------1----1------------------------2------------419-743E1----------5-16---------------19-------------5-------1248-----------21-------2----1--1-22---22-432-1------5--1--GG---1-----------22--212-----1--1---------------44322222-2--1------1--2-A122-2-A-32-3-2--321212--21----1-23----------------21---1---------------------------------4------------1---------------1--------------------------B-----------------------------------------------------------1--------------------1--6---4-----1-2-----------3-1-------------------1-2----------1------1-1---28-2-----24---1----9---3-----------------21K-1-211-1---1821-2216---------1--8B7--72---4-1R6R71---2------3*rm5***uF2E---------------------------------------------------------------------------S47447--------------------------------1--1--------------------------------3-312-2--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 98.0 SQ:SECSTR ##ccEcccccEEccEEEEEEccGGGcccccHHHHHHHHHHHHHHHHHTTcEEEEEEEccccEEEEEEccTTTcHHHHHHHHHHHHHHHHHHHcTHHHHHHccccccccccEEEEEccccHHHHHHHHTccccccHHHHHHHHHHHHTcccc# DISOP:02AL 1-6,131-137,150-153| PSIPRED cccHHccccEEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHHcHHHHHHHcccccccccccccc //