[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69939.1
DDBJ      :             cell adherance/invasion protein
Swiss-Prot:INVH_SALTY   RecName: Full=Invasion lipoprotein invH;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->147 PF04741 * InvH 6e-56 87.1 %
:HMM:PFM   1->147 PF04741 * InvH 3.6e-99 91.2 147/147  
:BLT:SWISS 1->147 INVH_SALTY 7e-70 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69939.1 GT:GENE ACF69939.1 GT:PRODUCT cell adherance/invasion protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 3018903..3019346 GB:FROM 3018903 GB:TO 3019346 GB:DIRECTION + GB:PRODUCT cell adherance/invasion protein GB:NOTE identified by match to protein family HMM PF04741 GB:PROTEIN_ID ACF69939.1 GB:DB_XREF GI:194409720 LENGTH 147 SQ:AASEQ MKKFYSCLPVFLLIGCAQVPLPSSVSKPVQQPGAQKEQLANANSIDECQSLPYVPSDLAKNKSLSNQNADNSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLAAHERLQAL GT:EXON 1|1-147:0| SW:ID INVH_SALTY SW:DE RecName: Full=Invasion lipoprotein invH;Flags: Precursor; SW:GN Name=invH; OrderedLocusNames=STM2900; SW:KW Cell membrane; Cell outer membrane; Complete proteome; Lipoprotein;Membrane; Palmitate; Signal; Virulence. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->147|INVH_SALTY|7e-70|100.0|147/147| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| SEG 65->82|snqnadnsasknsaisss| RP:PFM:NREP 1 RP:PFM:REP 1->147|PF04741|6e-56|87.1|147/147|InvH| HM:PFM:NREP 1 HM:PFM:REP 1->147|PF04741|3.6e-99|91.2|147/147|InvH| GO:PFM:NREP 1 GO:PFM GO:0009405|"GO:pathogenesis"|PF04741|IPR006830| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,22-44,61-78,147-148| PSIPRED ccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcHHHHHHHHccccccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcc //