[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69947.1
DDBJ      :             ferric enterobactin transport protein FepE
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.60
:378 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   64->329 3b8mA PDBj e-101 73.2 %
:RPS:PDB   64->329 3b8mC PDBj 3e-22 60.6 %
:RPS:SCOP  64->329 3b8mA1  d.58.60.1 * 4e-49 72.0 %
:RPS:PFM   26->155 PF02706 * Wzz 2e-05 31.9 %
:HMM:PFM   26->159 PF02706 * Wzz 6.5e-23 23.3 129/152  
:HMM:PFM   200->263 PF05332 * DUF743 5.8e-06 18.8 64/105  
:BLT:SWISS 1->372 FEPE_ECOLI e-142 67.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69947.1 GT:GENE ACF69947.1 GT:PRODUCT ferric enterobactin transport protein FepE GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 698026..699162 GB:FROM 698026 GB:TO 699162 GB:DIRECTION + GB:PRODUCT ferric enterobactin transport protein FepE GB:NOTE identified by match to protein family HMM PF02706 GB:PROTEIN_ID ACF69947.1 GB:DB_XREF GI:194409728 LENGTH 378 SQ:AASEQ MPSLNVKQEKNQSFAGYSLPPANSHEIDLFSLIEVLWQAKRRILATVFAFACVGLLLSFLLPQKWTSQAIVTPAESIQWQGLERTLTALRVLDMEVSVDRASVFNLFIKKFSSPSLLEEYLRSSPYVMDQLKGAQIDEQDLHRAIVLLSEKMKAVDSNAGKKNETSLFTSWTLSFTAPTREEAQKVLAGYIQYISDIVVKETLENIRNQLEIKTRYEQEKLAMDRVRLKNQLDANIQRLHYSLEIANAAGIKRPVYSNGQAVKDDPDFSISLGADGISRKLEIEKGVTDVAEIDGDLRNRQYHVEQLAAMNVSDVKFTPFKYQLSPSLPVKKDGPGKAVIIILAALIGGMMACGGVLLRHAMVSRKMENALAIDERLV GT:EXON 1|1-378:0| BL:SWS:NREP 1 BL:SWS:REP 1->372|FEPE_ECOLI|e-142|67.7|372/377| TM:NTM 2 TM:REGION 34->56| TM:REGION 338->360| SEG 165->176|tslftswtlsft| SEG 338->352|aviiilaaliggmma| BL:PDB:NREP 1 BL:PDB:REP 64->329|3b8mA|e-101|73.2|254/255| RP:PDB:NREP 1 RP:PDB:REP 64->329|3b8mC|3e-22|60.6|254/255| RP:PFM:NREP 1 RP:PFM:REP 26->155|PF02706|2e-05|31.9|119/160|Wzz| HM:PFM:NREP 2 HM:PFM:REP 26->159|PF02706|6.5e-23|23.3|129/152|Wzz| HM:PFM:REP 200->263|PF05332|5.8e-06|18.8|64/105|DUF743| GO:PFM:NREP 2 GO:PFM GO:0009103|"GO:lipopolysaccharide biosynthetic process"|PF02706|IPR003856| GO:PFM GO:0016020|"GO:membrane"|PF02706|IPR003856| RP:SCP:NREP 1 RP:SCP:REP 64->329|3b8mA1|4e-49|72.0|254/255|d.58.60.1| OP:NHOMO 121 OP:NHOMOORG 76 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111-3221311232-23423-1323222333332---1111111111111112-1-11-2321113--111111111111--1---------------1----1-----------------------------------------------------------1--------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 267 STR:RPRED 70.6 SQ:SECSTR ##############################################################ccEEEEEEEEcccGGGGHHHHHHHHHHHHTTccccccHHHHHHHHHHHHTcHHHHHHHHTTcHHHHHccTHHHccccHHHHHHHHHHTTEEEETTTcccTTcccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccccTTcHHHHHHHHHHHHHcccTTTTcHHHHHHHHHHHHHHHcccccccccccEEEEccccc################################################# DISOP:02AL 1-21,132-142,157-161,253-267| PSIPRED ccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //