[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69961.1
DDBJ      :             PTS system, IIc component
Swiss-Prot:SGCC_ECOLI   RecName: Full=Putative permease IIC component;AltName: Full=Putative PTS system EIIC component;

Homologs  Archaea  0/68 : Bacteria  135/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:437 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   31->378 PF03611 * EIIC-GAT 2e-29 38.7 %
:HMM:PFM   3->388 PF03611 * EIIC-GAT 2.7e-83 28.3 367/412  
:BLT:SWISS 1->437 SGCC_ECOLI 0.0 92.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69961.1 GT:GENE ACF69961.1 GT:PRODUCT PTS system, IIc component GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1751290..1752603 GB:FROM 1751290 GB:TO 1752603 GB:DIRECTION + GB:PRODUCT PTS system, IIc component GB:NOTE identified by match to protein family HMM PF03611; match to protein family HMM TIGR00827 GB:PROTEIN_ID ACF69961.1 GB:DB_XREF GI:194409742 LENGTH 437 SQ:AASEQ MFDYILSLGGTVFVPIIMIIIGLIFRIPWLQAVKAGVTVGIGFVGMGLVIVMAIDSLSPPIKVMIERFGLTLHVFDVGAGPASGVGYATAIGAMIIPVIFLLNVGMLVTRLTKTMNVDIYNYWHYAITGTVVQLMTGSLIYGVLGAICHAALSLKMADWTAKRVQNIVGLEGISIPQGYGSSSVPLFVLLDAVYEKIPFMKGRNIDAQEIQKRYGMVGDPVIIGVVLGLIFGLAAGEGFKGCATLMITVAAIMVLFPRMIRLIVEGLMPISDGARKFFQKHFKGREVFIGLDTAVTLGHPTTIAVGLLLIPIMLILASILPGNKVLPLADLPVAPFFICMATVIHRGDLIRTLLSGIIVMITVLLIATQFAPYFTDMALKGGFSFAAENAQITALSVGNMFGWSISELMSLGMIGVVIVVGIVASIILVLRKRELPE GT:EXON 1|1-437:0| SW:ID SGCC_ECOLI SW:DE RecName: Full=Putative permease IIC component;AltName: Full=Putative PTS system EIIC component; SW:GN Name=sgcC; Synonyms=yjhN; OrderedLocusNames=b4304, JW4266; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Phosphotransferase system; Sugar transport; Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->437|SGCC_ECOLI|0.0|92.9|437/437| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|Phosphotransferase system| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 11 TM:REGION 5->27| TM:REGION 38->60| TM:REGION 87->109| TM:REGION 131->153| TM:REGION 170->192| TM:REGION 216->238| TM:REGION 247->269| TM:REGION 301->323| TM:REGION 326->348| TM:REGION 350->372| TM:REGION 409->430| SEG 16->27|iimiiiglifri| SEG 409->430|mslgmigvvivvgivasiilvl| RP:PFM:NREP 1 RP:PFM:REP 31->378|PF03611|2e-29|38.7|336/414|EIIC-GAT| HM:PFM:NREP 1 HM:PFM:REP 3->388|PF03611|2.7e-83|28.3|367/412|EIIC-GAT| GO:PFM:NREP 2 GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF03611|IPR004703| GO:PFM GO:0016021|"GO:integral to membrane"|PF03611|IPR004703| OP:NHOMO 226 OP:NHOMOORG 135 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------1--------------1-----------11---------------------------------------------------------------------------------------------------------------------21--1--------1--333333---11111111111111-----1-1-23-13-2221144-1---1---2422------1111111111111111111111111--------1---13-----------3--------------------------1-1---------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------2222221211-232221-121233222221112-----3-23232353333333-1111111--------------------------------------------11------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 435-438| PSIPRED cccHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccc //