[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69992.1
DDBJ      :             putative formate transporter FocA
Swiss-Prot:FOCA_ECOLI   RecName: Full=Probable formate transporter 1;AltName: Full=Formate channel 1;

Homologs  Archaea  16/68 : Bacteria  322/915 : Eukaryota  66/199 : Viruses  0/175   --->[See Alignment]
:271 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->263 PF01226 * Form_Nir_trans 2e-41 48.4 %
:HMM:PFM   2->264 PF01226 * Form_Nir_trans 1e-84 45.5 244/250  
:BLT:SWISS 1->271 FOCA_ECOLI e-145 95.6 %
:PROS 69->78|PS01005|FORMATE_NITRITE_TP_1
:PROS 154->164|PS01006|FORMATE_NITRITE_TP_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69992.1 GT:GENE ACF69992.1 GT:PRODUCT putative formate transporter FocA GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1061826..1062641) GB:FROM 1061826 GB:TO 1062641 GB:DIRECTION - GB:PRODUCT putative formate transporter FocA GB:NOTE identified by match to protein family HMM PF01226; match to protein family HMM TIGR00790 GB:PROTEIN_ID ACF69992.1 GB:DB_XREF GI:194409773 LENGTH 271 SQ:AASEQ MAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTGAMPYGMAKLIGGICFSLGLILCVICGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFGNLIGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKMHHTFIEAVCLGILANLMVCLAVWMSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFATPEFWTAVGSSPESFSHLTVMSFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRGNEHH GT:EXON 1|1-271:0| SW:ID FOCA_ECOLI SW:DE RecName: Full=Probable formate transporter 1;AltName: Full=Formate channel 1; SW:GN Name=focA; Synonyms=ycaE; OrderedLocusNames=b0904, JW0887; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->271|FOCA_ECOLI|e-145|95.6|271/285| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 69->78|PS01005|FORMATE_NITRITE_TP_1|PDOC00769| PROS 154->164|PS01006|FORMATE_NITRITE_TP_2|PDOC00769| TM:NTM 6 TM:REGION 19->41| TM:REGION 60->82| TM:REGION 102->123| TM:REGION 146->168| TM:REGION 172->194| TM:REGION 234->256| SEG 246->258|igniigggllvgl| RP:PFM:NREP 1 RP:PFM:REP 1->263|PF01226|2e-41|48.4|244/248|Form_Nir_trans| HM:PFM:NREP 1 HM:PFM:REP 2->264|PF01226|1e-84|45.5|244/250|Form_Nir_trans| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF01226|IPR000292| GO:PFM GO:0006810|"GO:transport"|PF01226|IPR000292| GO:PFM GO:0016020|"GO:membrane"|PF01226|IPR000292| OP:NHOMO 603 OP:NHOMOORG 404 OP:PATTERN ----------------1---------------1--1-111111-1212---------112-------- ------1--------------1---1------1111--------11--1------1---------------------1-111------------11-------------------------------------------------1------------111111----------1---1-1----------1113333333313233321-22-23311---112111111-1-11111111-11111211--2--------------------1-111---1111--------------1-11111111111---------1---111111111212-2---221-2---11---11--11--11--1--11-------------11-----11--1------------11-11111-------------------1---1------2--------1------1---------------------------------------1-1111-----------------------------1-------1-1--11--1--------111-12-111----1--------11-1-1-------11-11-----------------1------222111--1-211111-1111111111111--1----------21111223222322233-3333322233323333332111111112222222222222222223311222-322222222121-----------------1222111111111111----------11----1------1-1-11----------22332222223333--------------------------------1--------------------------------------1- 11------1-----1-1-211211121-------------------11--2121-----111111111111111111111111111---11-1-1-------1-----26------------------------------------------------------------------651G11132-------11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 268-272| PSIPRED cHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHcccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //