[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69996.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   116->169 PF08066 * PMC2NT 0.00021 22.2 54/91  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69996.1 GT:GENE ACF69996.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2829108..2829749 GB:FROM 2829108 GB:TO 2829749 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69996.1 GB:DB_XREF GI:194409777 LENGTH 213 SQ:AASEQ MSFQAFRKDIDVMSEDYVIEWDNNFADDLNVVANVFLSHNPTLWPTIFSQLSTQPEIFEDEDEDEYGLQDVLDCSGGDLGNNELAQAFLQVLRGEGFIHLVDWKGEDEEGELANFAADRFYELTKNLTDSEELRNLLVEITQEDEISDVCEAGDRYLDEIFERIQTELNKRGFQIFDLNEGSDTYNVVVLPMSEYKKIEDFNTPWLEVQDFLS GT:EXON 1|1-213:0| HM:PFM:NREP 1 HM:PFM:REP 116->169|PF08066|0.00021|22.2|54/91|PMC2NT| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1----------------------1-11111111-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccHHccHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEEHHHHHHHHHccccHHHHHHHHc //