[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70003.1
DDBJ      :             ferredoxin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:134 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  85->134 1jkuA  a.25.1.3 * 5e-04 26.1 %
:HMM:PFM   6->98 PF03692 * UPF0153 8.7e-14 29.5 78/85  
:HMM:PFM   94->117 PF09749 * HVSL 0.00096 41.7 24/239  
:BLT:SWISS 1->109 YKGJ_ECOLI 1e-48 74.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70003.1 GT:GENE ACF70003.1 GT:PRODUCT ferredoxin GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1876679..1877083 GB:FROM 1876679 GB:TO 1877083 GB:DIRECTION + GB:PRODUCT ferredoxin GB:NOTE identified by match to protein family HMM PF03692 GB:PROTEIN_ID ACF70003.1 GB:DB_XREF GI:194409784 LENGTH 134 SQ:AASEQ MSVLNPCMTCGACCAYFRVSFYWAEGDDASGRVPASLTEPVTPFLRCMAGTNQKQPHCKALIGTPGENVSCAIYENRPSTCREFSISGEGGEVNEACNRARARYGLPPLYKDMLFHTTADAATVELSRVQLPAN GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 1->109|YKGJ_ECOLI|1e-48|74.3|109/109| TM:NTM 1 TM:REGION 1->22| HM:PFM:NREP 2 HM:PFM:REP 6->98|PF03692|8.7e-14|29.5|78/85|UPF0153| HM:PFM:REP 94->117|PF09749|0.00096|41.7|24/239|HVSL| RP:SCP:NREP 1 RP:SCP:REP 85->134|1jkuA|5e-04|26.1|46/266|a.25.1.3| OP:NHOMO 98 OP:NHOMOORG 96 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------1-----------------------------------1---1-----------------------------------1121---1---1----11-----------21-1-----------------------------------------------------------------------------------------------------111---111-1111----111-1----1--11-111111-1--11111111111111111--------1-1--------------1-----------1-----------------111111----1-11-11111111111---------------------------11111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,133-135| PSIPRED cccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEEEcccccccEEEEEEcccccEEEEEEEccccccccccccccccccccHHHHHHHHHHcccccccHHEEEEccccEEEEEEEEEcccc //