Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70051.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70051.1 GT:GENE ACF70051.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1119065..1119253 GB:FROM 1119065 GB:TO 1119253 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF70051.1 GB:DB_XREF GI:194409832 LENGTH 62 SQ:AASEQ MKEGYYWIQHNGVVQVAYYTNDTVDDLESGQLIVGVWHLTRGDDICHNGEAEVLSGPLQPPA GT:EXON 1|1-62:0| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-21-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,60-63| PSIPRED ccccEEEEEEccEEEEEEEEcccccccccccEEEEEEEEccccccccccccEEEEccccccc //