[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70056.1
DDBJ      :             putative homeobox protein
Swiss-Prot:YBGS_SALTY   RecName: Full=Uncharacterized protein ybgS;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->72 PF03964 * Chorion_2 0.0004 17.0 47/117  
:BLT:SWISS 45->128 YBGS_SALTY 7e-34 98.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70056.1 GT:GENE ACF70056.1 GT:PRODUCT putative homeobox protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(871305..871691) GB:FROM 871305 GB:TO 871691 GB:DIRECTION - GB:PRODUCT putative homeobox protein GB:PROTEIN_ID ACF70056.1 GB:DB_XREF GI:194409837 LENGTH 128 SQ:AASEQ MKMTKLTTLLLTATLGLASGAALAAESNAQSSNGQANSAANAGQVAPDARQNVAPNDVNNNDINTNGNTNSTMQHPDGSTMNHDGMTKDEEHKNTMCKDGRCPDINKKVETSNGVNNDVNTKTDGTTQ GT:EXON 1|1-128:0| SW:ID YBGS_SALTY SW:DE RecName: Full=Uncharacterized protein ybgS;Flags: Precursor; SW:GN Name=ybgS; OrderedLocusNames=STM0759; SW:KW Complete proteome; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 45->128|YBGS_SALTY|7e-34|98.8|84/128| SEG 6->44|lttllltatlglasgaalaaesnaqssngqansaanagq| SEG 52->70|nvapndvnnndintngntn| HM:PFM:NREP 1 HM:PFM:REP 26->72|PF03964|0.0004|17.0|47/117|Chorion_2| OP:NHOMO 57 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1111111111-1111111111111111111111-----1111111111111111-1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,24-44,74-88,121-129| PSIPRED ccHHHHHHHHHHHHHHHHccccHHccccccccccccccccccccccccHHHccccccccccccccccccccEEEcccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccc //