[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70086.1
DDBJ      :             transposase InsF for insertion sequence IS3A/B/C/D/E/fA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  499/915 : Eukaryota  2/199 : Viruses  3/175   --->[See Alignment]
c.55.3
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   125->250 1cxuA PDBj 2e-14 18.7 %
:RPS:SCOP  126->281 1b92A  c.55.3.2 * 9e-13 10.9 %
:HMM:SCOP  119->286 1c0mA2 c.55.3.2 * 3.5e-38 29.4 %
:HMM:PFM   123->239 PF00665 * rve 2.8e-29 25.6 117/120  
:HMM:PFM   66->137 PF04051 * TRAPP 0.00016 27.7 65/151  
:BLT:SWISS 1->283 INSF_ECOLI 5e-55 41.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70086.1 GT:GENE ACF70086.1 GT:PRODUCT transposase InsF for insertion sequence IS3A/B/C/D/E/fA GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1518591..1519448 GB:FROM 1518591 GB:TO 1519448 GB:DIRECTION + GB:PRODUCT transposase InsF for insertion sequence IS3A/B/C/D/E/fA GB:NOTE identified by match to protein family HMM PF00665 GB:PROTEIN_ID ACF70086.1 GB:DB_XREF GI:194409867 LENGTH 285 SQ:AASEQ MRFQFITDYRGSLSRSRICRLMGVTDRGLRAWKRRPPSLRQRRDLILLAHIREQHRLCLGSYGRPRMTEELKALGLQVGQRRVGRLMRQNNITVVRTRKFKRTTDSHHTFNIAPNLLKQDFSASAPNQKWAGDITYVWTREGWVYLAVILDLYSRRVIGWATGDRLKQDLALRALNMALALRKPPPGCIQHTDRGSQYCAHEYQKLLLKHQLLPSMSGKGNCFDNSAVESFFKSLKAELIWRRHWQTRRDIEIAIFEYINGFYNPRRRHSTLGWKSPVAFEKKAA GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 1->283|INSF_ECOLI|5e-55|41.0|278/288| SEG 93->104|tvvrtrkfkrtt| SEG 170->182|lalralnmalalr| RP:PDB:NREP 1 RP:PDB:REP 125->250|1cxuA|2e-14|18.7|123/143| HM:PFM:NREP 2 HM:PFM:REP 123->239|PF00665|2.8e-29|25.6|117/120|rve| HM:PFM:REP 66->137|PF04051|0.00016|27.7|65/151|TRAPP| RP:SCP:NREP 1 RP:SCP:REP 126->281|1b92A|9e-13|10.9|137/144|c.55.3.2| HM:SCP:REP 119->286|1c0mA2|3.5e-38|29.4|160/0|c.55.3.2|1/1|Ribonuclease H-like| OP:NHOMO 3939 OP:NHOMOORG 504 OP:PATTERN -------------------------------------------------------------------- 1-HI-OBK443N-E1H111-1K--56G4HHE-EDFC14BH-1273--4---3-1--4*---26---9212-5---93-1-47-----1--F---7-1----3-61475--------------------633214-2------4---91----------------1-3----------------5--1----174----462768C686B-5992-741-33314-2--2-26121116----1211-2-2--3-5--E8-N-6-11637-851941OkO561BAi9-84-2-4254344232413645467272--367------7-41121111-8-R-22---12AI-2--2-1B421343--112---5-5-BF----------C3312---1--22332223232-5-2--1-8121--443---2--12-5-1-5-2-11B3-1DDDDDDDD156C1B---------------------1-------------------X4--F95611--GF553443-2-8F-22H-289987D3623C--58131-11-22------DP3B-4-13132-D---------25-B13-----4------------------------D-2--2-J338-84--31PGOB8C-98B51nLA736----27--------1151226PRD73E86D-O985B581*6R5BBB5CB3514--81-381-131149E-4--G6*g*****--FC9B4DABA15---6------5-11433-F899-15-112-1-----52--5BBI7833D11-41-341-5A9E---------42---65645P1B25D3MAH7966C------9-----C4----------16981-----21------C--3-----2-8--------- -----------------------------------------------------------------------------------------------------------------------------------------------3--------------------------------------------2---------- ------------------------------------------------------------1-----------------------------------------------------------------------------------------1-----1------------------ STR:NPRED 171 STR:RPRED 60.0 SQ:SECSTR ################################################################################################################cccTTTEccccccTTcEEEEEEEEcGGGTTccEEEEEEETTTccEEEEEEccccHHHHHHHHHHHHHHHcccccccEEEEEccHHHHcHHHHHHHHHHTcEEEEEcTTcHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHccccccHHHHHHHHHcHc## DISOP:02AL 284-286| PSIPRED cHHHHHHHHHHHccHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccEEEcHHHHHHHHHHccccccccccccccccccccccccccHHccccccccccEEEEEEEEEccccccEEEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHcccccEEcccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHcccccHHHHHHHcc //