[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70099.1
DDBJ      :             lipoprotein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  540/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:276 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->254 3gxaC PDBj 3e-52 45.9 %
:RPS:PDB   27->273 1b1xA PDBj 6e-21 8.9 %
:RPS:SCOP  32->258 1p99A  c.94.1.1 * 1e-64 33.9 %
:HMM:SCOP  31->271 1p99A_ c.94.1.1 * 4.6e-65 44.3 %
:RPS:PFM   35->257 PF03180 * Lipoprotein_9 2e-50 49.3 %
:HMM:PFM   32->260 PF03180 * Lipoprotein_9 4.4e-80 42.7 227/237  
:BLT:SWISS 15->249 METQ_YERPE 5e-33 40.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70099.1 GT:GENE ACF70099.1 GT:PRODUCT lipoprotein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 618360..619190 GB:FROM 618360 GB:TO 619190 GB:DIRECTION + GB:PRODUCT lipoprotein GB:NOTE identified by match to protein family HMM PF03180 GB:PROTEIN_ID ACF70099.1 GB:DB_XREF GI:194409880 LENGTH 276 SQ:AASEQ MGLRQSLRIAASTLLLACGLQFAHADSSPQTIVFGVAPGPYGDMVKQAIAPTLKEKGYKVVVREFSDYVQPNMALANGSIDANLFQHTLYFDKFTADKGLKLSKLIVVPTAGMGFYSRKINSLDALKKGDIITLSNDPTNLARGLRFLQSLGLITIKDNIDPTKASERDIASNPKGLVFKPLEAAQLPRTLDGVTGALVNGNFAVAAGLDLSSAIKQEHLDENLKNIIAVRSEDADKPFAKDIVEAVKSPAYRAVIDDPKNIYSAFQKPEWMTATP GT:EXON 1|1-276:0| BL:SWS:NREP 1 BL:SWS:REP 15->249|METQ_YERPE|5e-33|40.9|225/271| BL:PDB:NREP 1 BL:PDB:REP 32->254|3gxaC|3e-52|45.9|222/244| RP:PDB:NREP 1 RP:PDB:REP 27->273|1b1xA|6e-21|8.9|246/689| RP:PFM:NREP 1 RP:PFM:REP 35->257|PF03180|2e-50|49.3|221/236|Lipoprotein_9| HM:PFM:NREP 1 HM:PFM:REP 32->260|PF03180|4.4e-80|42.7|227/237|Lipoprotein_9| RP:SCP:NREP 1 RP:SCP:REP 32->258|1p99A|1e-64|33.9|224/257|c.94.1.1| HM:SCP:REP 31->271|1p99A_|4.6e-65|44.3|235/255|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1065 OP:NHOMOORG 543 OP:PATTERN -------------------------------------------------------------------- -----2211111111----------2------1121112-----121211111-1111-----111121111222111-122-------------------1---------------11111111----------------------------------------------------------1-2------12444444442444444313312344112244322222223322222222222222422223212232311132334412123144433341111111111111111111111111111111112221111-2112333333313--2221---111211----11-1-11-1-11-1-11---111-111-11-125---322-222222222213---2--2-2-1--21121111111132-----11411---11111111-11---13-----------------------------------343435455552444255434444235484344--222--2228-113--------111111111--------------1-------------------1----2211444441121111111-1-----221-1-----1--------------------------------43431422222222222-2222222222222222221676441142222222222222222422211121-322222222222--1-111111111---1-22211111111211144444321111-33333543234341333111111111-1111111111211111111111111111---4---------------1----------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------5-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 90.2 SQ:SECSTR ########################cccccccEEEEEccHHHHHHHHHHHHHHHHTTcccEEEEEcccHHHHHHHHHTTccccEEEcHHHHHHHHcTTTcEEEEEEEEcEEEEEEEETTccccGGGcTTcEEEccTTcTTTTHHHHHHcHHHHcccccTTccHHHHHHHHccEEEcTTccTTTcGGGTTTccccTTTTTcccTTcTTcHHHHHHHHHTTcccEEEEEccHHHHHcccHHHHTTEEEEETTTEEEEGGGTTTcccEEEEccEEEE### DISOP:02AL 1-1,21-29,275-277| PSIPRED ccHHHHHHHHHHHHHHHHccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHcccccEEEEccHHHHHHHHHHccccEEEEEEEEEEEEEEEccccccHHHcccccEEEEccccccHHHHHHHHHHcccEEEccccccccccHHHHHccccccEEEEEcHHHHHHHHccccEEEEcHHHHHHcccccHHcEEEccccccEEEEEEEcHHHcccHHHHHHHHHHccHHHHHHHHHHHcccccEEEcccccccc //