[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70101.1
DDBJ      :             hydrolase, nudix family
Swiss-Prot:NUDI_SALHS   RecName: Full=Nucleoside triphosphatase nudI;         EC=3.6.1.-;

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->141 3dupB PDBj 7e-09 7.4 %
:RPS:SCOP  2->137 1ryaA  d.113.1.5 * 1e-08 14.2 %
:HMM:SCOP  1->137 1ryaA_ d.113.1.5 * 2.4e-23 31.3 %
:RPS:PFM   10->43 PF00293 * NUDIX 1e-04 47.1 %
:HMM:PFM   3->134 PF00293 * NUDIX 1.3e-23 26.0 127/135  
:BLT:SWISS 1->141 NUDI_SALHS 3e-68 100.0 %
:PROS 38->59|PS00893|NUDIX_BOX
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70101.1 GT:GENE ACF70101.1 GT:PRODUCT hydrolase, nudix family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2450159..2450584 GB:FROM 2450159 GB:TO 2450584 GB:DIRECTION + GB:PRODUCT hydrolase, nudix family GB:NOTE identified by match to protein family HMM PF00293 GB:PROTEIN_ID ACF70101.1 GB:DB_XREF GI:194409882 LENGTH 141 SQ:AASEQ MRQRTIVCPLIQNDGCYLLCKMVDNRGVFPGQWALSGGGVEPGERIEEALRREIREELGEQLILSDITPWTFRDDIRVKTYADGRQEEIYMIYLIFDCVSANRDICINDEFQDYAWVKPEELALYDLNVATRHTLALKGLL GT:EXON 1|1-141:0| SW:ID NUDI_SALHS SW:DE RecName: Full=Nucleoside triphosphatase nudI; EC=3.6.1.-; SW:GN Name=nudI; OrderedLocusNames=SeHA_C2535; SW:KW Complete proteome; Hydrolase; Magnesium. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->141|NUDI_SALHS|3e-68|100.0|141/141| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| PROS 38->59|PS00893|NUDIX_BOX|PDOC00695| SEG 44->64|erieealrreireelgeqlil| RP:PDB:NREP 1 RP:PDB:REP 2->141|3dupB|7e-09|7.4|135/277| RP:PFM:NREP 1 RP:PFM:REP 10->43|PF00293|1e-04|47.1|34/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 3->134|PF00293|1.3e-23|26.0|127/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 2->137|1ryaA|1e-08|14.2|134/160|d.113.1.5| HM:SCP:REP 1->137|1ryaA_|2.4e-23|31.3|134/160|d.113.1.5|1/1|Nudix| OP:NHOMO 55 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111111111-1111111111111111111111--1--1111111111111111----1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEccTTccEEEEEEEcTTccccTTcEEEEEEEccTTccHHHHHHHHHHHHHcccGGGccHHHHTTcEEEEEEEEEEETTEEEEEEEEEEEEEccTTcccccTTccEEEEEEHHHHHHHHHHcccccTTHHHHHH DISOP:02AL 1-1| PSIPRED cccEEEEEEEEEcccEEEEEEEcccccccccEEEcccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEEccccEEEEEcccccccEEEEEEEEEEEEccccccccccccEEEEccHHHHHccccccccHHHHHHcccc //