[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70162.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->64 PF07627 * PSCyt3 2.3e-05 32.1 28/102  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70162.1 GT:GENE ACF70162.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2642086..2642316) GB:FROM 2642086 GB:TO 2642316 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF70162.1 GB:DB_XREF GI:194409943 LENGTH 76 SQ:AASEQ MKINNGPVLCPHCGCLSAYYEIDRLAAIREKVNKEGGSAAWDSTLQAHKKKAFCLMCHKSIDEVVIGQSDAPEATK GT:EXON 1|1-76:0| HM:PFM:NREP 1 HM:PFM:REP 37->64|PF07627|2.3e-05|32.1|28/102|PSCyt3| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,68-77| PSIPRED cccccccEEcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccc //