[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70207.1
DDBJ      :             excisionase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  7/175   --->[See Alignment]
:82 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->58 1c0iA PDBj 9e-04 42.0 %
:RPS:PFM   7->73 PF06806 * DUF1233 5e-23 70.1 %
:HMM:PFM   4->74 PF06806 * DUF1233 1.4e-38 64.8 71/72  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70207.1 GT:GENE ACF70207.1 GT:PRODUCT excisionase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1103934..1104182) GB:FROM 1103934 GB:TO 1104182 GB:DIRECTION - GB:PRODUCT excisionase GB:NOTE identified by match to protein family HMM PF06806 GB:PROTEIN_ID ACF70207.1 GB:DB_XREF GI:194409988 LENGTH 82 SQ:AASEQ MSNIIQLTPNKWVSEKVLIAVTGLKPGTITRARKESWMLGREYLHISPDGNPKPSSECIYNREAVDQWIEAQKKNQPGAKTT GT:EXON 1|1-82:0| BL:PDB:NREP 1 BL:PDB:REP 8->58|1c0iA|9e-04|42.0|50/363| RP:PFM:NREP 1 RP:PFM:REP 7->73|PF06806|5e-23|70.1|67/69|DUF1233| HM:PFM:NREP 1 HM:PFM:REP 4->74|PF06806|1.4e-38|64.8|71/72|DUF1233| OP:NHOMO 41 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------32-----1--11-2--41-12-1---1----------1---1--11-1121--1---------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------1-11------1------111------------------ STR:NPRED 50 STR:RPRED 61.0 SQ:SECSTR #######HHHHHHHHTTTTccEEEE#EEEEEEccGGGGGGGTTTTTcTTcEEccGGGc######################## DISOP:02AL 1-1,73-83| PSIPRED cccEEEEcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEcHHHHHHHHHHHcccccccccc //