[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70221.1
DDBJ      :             protein YcgN
Swiss-Prot:YCGN_SALTY   RecName: Full=UPF0260 protein ycgN;

Homologs  Archaea  0/68 : Bacteria  286/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   29->97 PF03692 * UPF0153 6.1e-11 33.8 65/85  
:BLT:SWISS 1->153 YCGN_SALTY 5e-95 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70221.1 GT:GENE ACF70221.1 GT:PRODUCT protein YcgN GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1958225..1958686) GB:FROM 1958225 GB:TO 1958686 GB:DIRECTION - GB:PRODUCT protein YcgN GB:NOTE identified by match to protein family HMM PF03692 GB:PROTEIN_ID ACF70221.1 GB:DB_XREF GI:194410002 LENGTH 153 SQ:AASEQ MADTLMSDTPFWQRKTLDEMTDAEWESLCDGCGQCCLHKLMDEDTDEIYFTNVACRQLNIKTCQCRHYERRFEFEPDCIKLTRENLPDFEWLPMTCAYRLLAEGKPLPTWHPLLTGSKAAMHGERISVRHIAVKESEVRDWQDHILNKPSWAE GT:EXON 1|1-153:0| SW:ID YCGN_SALTY SW:DE RecName: Full=UPF0260 protein ycgN; SW:GN Name=ycgN; OrderedLocusNames=STM1811; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->153|YCGN_SALTY|5e-95|100.0|153/153| HM:PFM:NREP 1 HM:PFM:REP 29->97|PF03692|6.1e-11|33.8|65/85|UPF0153| OP:NHOMO 287 OP:NHOMOORG 286 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-11-1111111111111111111111111-11111111111-11111111111111111111111111111111111111111-1------------------------------11111--------------------------------------------------------------------------------------111-11121-----------------------------------111111111111111111111111111111---11-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------1111111111111111111111111111111111111111111111111111111111111111111111111----------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,152-154| PSIPRED ccccccccccHHHcccHHHHcHHHHHHHHHHHHHHHHHHHHccccccEEEEccHHHHccccccccccHHHHHHHccHHHHccHHHHccccccccccHHHHHHcccccccccccccccHHHHHHHccHHcccEEcHHHHHHHHHHHcccccccc //