[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70243.1
DDBJ      :             HTH-type transcriptional regulator EutR
Swiss-Prot:EUTR_SALTY   RecName: Full=HTH-type transcriptional regulator eutR;AltName: Full=Ethanolamine operon regulatory protein;

Homologs  Archaea  0/68 : Bacteria  167/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1
:350 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   239->347 1bl0A PDBj 2e-15 14.2 %
:RPS:SCOP  200->339 1v4aA1  a.24.16.4 * 3e-10 17.2 %
:HMM:SCOP  238->291 1d5yA1 a.4.1.8 * 8.5e-10 27.8 %
:HMM:PFM   250->290 PF00165 * HTH_AraC 6.5e-10 19.5 41/42  
:HMM:PFM   301->343 PF00165 * HTH_AraC 1.9e-07 21.4 42/42  
:BLT:SWISS 1->350 EUTR_SALTY 0.0 99.7 %
:PROS 293->338|PS00041|HTH_ARAC_FAMILY_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70243.1 GT:GENE ACF70243.1 GT:PRODUCT HTH-type transcriptional regulator EutR GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2621295..2622347) GB:FROM 2621295 GB:TO 2622347 GB:DIRECTION - GB:PRODUCT HTH-type transcriptional regulator EutR GB:NOTE identified by match to protein family HMM PF00165 GB:PROTEIN_ID ACF70243.1 GB:DB_XREF GI:194410024 LENGTH 350 SQ:AASEQ MKKTRTANLHHLYHEALPEDVKLTPRVEVDNVHQRRTTDVYEHALTITAWQQIYDQLHPGKFHGEFTEILLDEIQVFREYTGLALRQSCLVWPNSFWFGIPATRGEQGFIGAQGLGSAEIATRPGGTEFELSTPDDYTILGVVISEDVISRQATFLHNPERVLHMLRNQLALEVKEQHKAALWGFVQQALATFSESPETLHQPAVRKVLSDNLLLAMGTMLEEAKPIHSAESISHQGYRRLLSRAREYVLENMSEPLTVLDLCNQLHVSRRTLQNAFHAILGIGPNAWLKRIRLNAVRRELISPWSQSTTVKDAAMQWGFWHLGQFATDYQQLFAEKPSLTLHQRMRQWA GT:EXON 1|1-350:0| SW:ID EUTR_SALTY SW:DE RecName: Full=HTH-type transcriptional regulator eutR;AltName: Full=Ethanolamine operon regulatory protein; SW:GN Name=eutR; OrderedLocusNames=STM2454; SW:KW Activator; Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->350|EUTR_SALTY|0.0|99.7|350/350| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 293->338|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| RP:PDB:NREP 1 RP:PDB:REP 239->347|1bl0A|2e-15|14.2|106/116| HM:PFM:NREP 2 HM:PFM:REP 250->290|PF00165|6.5e-10|19.5|41/42|HTH_AraC| HM:PFM:REP 301->343|PF00165|1.9e-07|21.4|42/42|HTH_AraC| RP:SCP:NREP 1 RP:SCP:REP 200->339|1v4aA1|3e-10|17.2|128/151|a.24.16.4| HM:SCP:REP 238->291|1d5yA1|8.5e-10|27.8|54/54|a.4.1.8|1/2|Homeodomain-like| OP:NHOMO 331 OP:NHOMOORG 168 OP:PATTERN -------------------------------------------------------------------- ---------------11----3---1------2-1-2-74---------21---1---------11----------------------------------------------------------------------------------1---2----11-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------12121--51212----------1----------1--4---455236---1------------------------------------------------------------16-------8785684333255224444147412241----2-21--11-112----211------------241----------------1---------------------------------------2--------2---1--------------------------------1--1---1111111111-1111111111111111111111-----1111111111111111-111-111-------------------------------3---------------11111-1-----22222235-222211--------------------------11----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 31.1 SQ:SECSTR ##############################################################################################################################################################################################################################################HHHHHHHHHHHHTTTTcccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHTcccc### DISOP:02AL 1-5,223-239,349-351| PSIPRED ccccccHHHHHHHHHccccccccccccccccEEEEccccHHHHHHHHHHHHHccEEEccccccEEEEEEEcccEEEEEEccHHHHHHHcccccccEEEEEEEcccccEEEccccccccEEEEEccccEEEEEcccccEEEEEEEcHHHHHHHHHHccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHcc //