[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70269.1
DDBJ      :             methylated-DNA-[protein]-cysteine S-methyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  242/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
a.4.2
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->127 2kifA PDBj 1e-25 51.5 %
:RPS:PDB   14->118 1eh6A PDBj 4e-23 29.5 %
:RPS:SCOP  33->118 1eh6A1  a.4.2.1 * 8e-26 33.7 %
:HMM:SCOP  30->114 1qntA1 a.4.2.1 * 7.2e-26 40.0 %
:RPS:PFM   33->112 PF01035 * DNA_binding_1 9e-12 46.2 %
:HMM:PFM   32->114 PF01035 * DNA_binding_1 6.1e-31 39.8 83/85  
:BLT:SWISS 1->129 YBAZ_SHIFL 1e-59 82.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70269.1 GT:GENE ACF70269.1 GT:PRODUCT methylated-DNA-[protein]-cysteine S-methyltransferase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(571081..571470) GB:FROM 571081 GB:TO 571470 GB:DIRECTION - GB:PRODUCT methylated-DNA-[protein]-cysteine S-methyltransferase GB:NOTE identified by match to protein family HMM PF01035; match to protein family HMM TIGR00589 GB:PROTEIN_ID ACF70269.1 GB:DB_XREF GI:194410050 LENGTH 129 SQ:AASEQ MLVSCASGLSSPLIPDYPEALTQDSIMDIQDTFPQRVWQIVASIPEGFVTTYGDVARLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGAISLTGPDLQRQRQALLAEGVVVSGSGQIDLQRYRWVY GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 1->129|YBAZ_SHIFL|1e-59|82.9|129/129| BL:PDB:NREP 1 BL:PDB:REP 31->127|2kifA|1e-25|51.5|97/102| RP:PDB:NREP 1 RP:PDB:REP 14->118|1eh6A|4e-23|29.5|105/168| RP:PFM:NREP 1 RP:PFM:REP 33->112|PF01035|9e-12|46.2|80/85|DNA_binding_1| HM:PFM:NREP 1 HM:PFM:REP 32->114|PF01035|6.1e-31|39.8|83/85|DNA_binding_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01035|IPR014048| GO:PFM GO:0006281|"GO:DNA repair"|PF01035|IPR014048| RP:SCP:NREP 1 RP:SCP:REP 33->118|1eh6A1|8e-26|33.7|86/90|a.4.2.1| HM:SCP:REP 30->114|1qntA1|7.2e-26|40.0|85/0|a.4.2.1|1/1|Methylated DNA-protein cysteine methyltransferase, C-terminal domain| OP:NHOMO 301 OP:NHOMOORG 290 OP:PATTERN -------------------------------------------------------------------- -1-----------------------2------1111----------------------------111-----------111-1-----111--1--1----11-1---2-------------------------1111111---1-1--1---1111111111--11-----1-----1--------------1---------------1------------11-21111111-------------------------------------------111-------1--------------------------1-------------1------------11----1-1----1--11--------111-----------------------1-------------------1--1--------------------1--------------------------------------------------------------------------------------------1-1------------1-----1-----1---------1----1-----11--1----11--------12-2------------------------------21--112-11-1111111111111111111-------------11121111111111111-111111111111111111111111---111111111111111111111111--111111111111--------------1121111--11----1---11111-1----1--1--1111-----111----------11111111111111------------------111111----------------------------------------------1-- ---------------11---111-1--11----111-111111111-1111111---11111111---------1-------1---11-1-111-2-111---------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 97.7 SQ:SECSTR #HHHHHHHHHHTGGGGccccccccHHHHcccHHHHHHHHHHHHccTTccEEHHHHHHHTTcTTcHHHHHHHTTcccccTTccGGGEEcTTccccccTTcHHHHHHHHHHTTccccccccccHHHHcc## DISOP:02AL 1-3| PSIPRED cccccHHHHHHHHccccHHHcccccccccccHHHHHHHHHHHccccccEEcHHHHHHHccccccHHHHHHHHHHccccccccccEEEccccccccccccHHHHHHHHHHcccEEccccEEcHHHHHccc //