[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70282.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->50 1zugA PDBj 8e-04 45.9 %
:RPS:PDB   10->76 2bnmA PDBj 1e-09 25.8 %
:RPS:SCOP  14->66 1perL  a.35.1.2 * 9e-09 28.3 %
:HMM:SCOP  5->66 2b5aA1 a.35.1.3 * 1.1e-09 33.9 %
:HMM:PFM   19->66 PF01381 * HTH_3 2.8e-12 43.8 48/55  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70282.1 GT:GENE ACF70282.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2339876..2340265) GB:FROM 2339876 GB:TO 2340265 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:NOTE identified by match to protein family HMM PF01381 GB:PROTEIN_ID ACF70282.1 GB:DB_XREF GI:194410063 LENGTH 129 SQ:AASEQ MKYNTMNNDEIILSLCARLKETRLSLSMTQQQLADRAHVGIATIKRIEKGGGLNLDTLISLLRALDKLHNLDAVLFESELRNFHESYEGGEGSGRLQVRQQAADLNNKSSAPQSEEVNYSAALENSLCW GT:EXON 1|1-129:0| BL:PDB:NREP 1 BL:PDB:REP 14->50|1zugA|8e-04|45.9|37/71| RP:PDB:NREP 1 RP:PDB:REP 10->76|2bnmA|1e-09|25.8|66/194| HM:PFM:NREP 1 HM:PFM:REP 19->66|PF01381|2.8e-12|43.8|48/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 14->66|1perL|9e-09|28.3|53/63|a.35.1.2| HM:SCP:REP 5->66|2b5aA1|1.1e-09|33.9|62/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------1-11------------------------------------11---1111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 78.3 SQ:SECSTR ####TccHcHHHHHHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHTTTcTTcTcHHHHHHHHHHTTccTGGGcTTccccHHHHHHHHHTTcccccccccccc######################## DISOP:02AL 1-7,85-114| PSIPRED cccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHcccccccHHHHHHcccccccccccccccccccccccccccEEcccccccccccc //