[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70310.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:40 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->38 PF09877 * DUF2104 0.00036 30.0 30/100  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70310.1 GT:GENE ACF70310.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(946442..946564) GB:FROM 946442 GB:TO 946564 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF70310.1 GB:DB_XREF GI:194410091 LENGTH 40 SQ:AASEQ MCTGMIDASVKTMSYIIGMIFSLRYMFSQGIAPWIEKEML GT:EXON 1|1-40:0| HM:PFM:NREP 1 HM:PFM:REP 9->38|PF09877|0.00036|30.0|30/100|DUF2104| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,5-7| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHc //