[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70314.1
DDBJ      :             glyoxylase family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  213/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->128 2p25A PDBj 1e-18 38.5 %
:RPS:PDB   2->128 3ct8A PDBj 1e-17 18.1 %
:RPS:SCOP  1->128 1twuA  d.32.1.8 * 2e-17 12.6 %
:HMM:SCOP  1->128 1ss4A_ d.32.1.6 * 4.3e-29 33.9 %
:RPS:PFM   6->121 PF00903 * Glyoxalase 8e-08 33.9 %
:HMM:PFM   7->126 PF00903 * Glyoxalase 1.6e-23 29.2 120/128  
:BLT:SWISS 1->129 YAER_ECOLI 1e-55 87.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70314.1 GT:GENE ACF70314.1 GT:PRODUCT glyoxylase family protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 285952..286341 GB:FROM 285952 GB:TO 286341 GB:DIRECTION + GB:PRODUCT glyoxylase family protein GB:NOTE identified by match to protein family HMM PF00903 GB:PROTEIN_ID ACF70314.1 GB:DB_XREF GI:194410095 LENGTH 129 SQ:AASEQ MLGLKQVHHIAIIATDYAVSKAFYCDILGFNLLSEAWREERDSWKGDLALNGQYVIELFSFPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEPIRIDPYTGKRFTFFNDPDGLPLELYEQ GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 1->129|YAER_ECOLI|1e-55|87.6|129/129| SEG 59->71|fsfpfpparpsrp| BL:PDB:NREP 1 BL:PDB:REP 5->128|2p25A|1e-18|38.5|122/124| RP:PDB:NREP 1 RP:PDB:REP 2->128|3ct8A|1e-17|18.1|127/132| RP:PFM:NREP 1 RP:PFM:REP 6->121|PF00903|8e-08|33.9|109/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 7->126|PF00903|1.6e-23|29.2|120/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->128|1twuA|2e-17|12.6|127/137|d.32.1.8| HM:SCP:REP 1->128|1ss4A_|4.3e-29|33.9|127/149|d.32.1.6|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 214 OP:NHOMOORG 214 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------1---111------------------------------------------11---------------111-----------------------111111111-111111--11-1111111--------------------------------1-----------------11---1111111111111-----------11111111111111111111111---11-------1-1-----111-------1-----------------------------------------------------------------1----------------1---------------------11------------------------------------------------------------------------------1-----1-----------1-------------------------------------------------------------------------11-1-11-111-1111-1-111--1------------------11111111111111111-111111111111111111111111--1111111111111111111111111--111111111111---------------1-11111-1--------1----------11-------------1----------------111111-11111111111111--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 100.0 SQ:SECSTR cTTTTTccEEEEEEccHHHHHHHHHHHHHHTTcEEEEEETTEEEEEETTEEEEEEEccGGGccccccTTcccccEEEEEcccHHHHHHHHHHHHHHTcccccTTTTTcTTccEEEEEcTTccEEEEEcE DISOP:02AL 1-2| PSIPRED cccccEEEEEEEEEccHHHHHHHHHHHHccEEEEEEcccccccEEEEEEEcccEEEEEEEccccccccccccccccEEEEEEEccHHHHHHHHHHcccEEEEEEEEccccEEEEEEEcccccEEEEEEc //