[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70330.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:37 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->32 PF09330 * Lact-deh-memb 0.00024 34.8 23/291  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70330.1 GT:GENE ACF70330.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(448767..448880) GB:FROM 448767 GB:TO 448880 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF70330.1 GB:DB_XREF GI:194410111 LENGTH 37 SQ:AASEQ MLAKIDKSLHIINKAYWHMICHSFYGDYLMQRKAKRG GT:EXON 1|1-37:0| HM:PFM:NREP 1 HM:PFM:REP 10->32|PF09330|0.00024|34.8|23/291|Lact-deh-memb| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--111-1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,33-38| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //