[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70332.1
DDBJ      :             citrate transporter
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  292/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
d.286.1
:608 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   255->398 2bkoA PDBj 2e-11 17.5 %
:RPS:SCOP  229->287 1vctA2  d.286.1.1 * 1e-07 33.9 %
:RPS:SCOP  321->387 1vctA2  d.286.1.1 * 2e-13 22.4 %
:HMM:SCOP  208->287 2fy8A2 d.286.1.1 * 1.3e-06 31.6 %
:HMM:SCOP  302->390 2fy8A2 d.286.1.1 * 6.6e-15 37.3 %
:RPS:PFM   9->200,420->519 PF03600 * CitMHS 3e-28 42.3 %
:RPS:PFM   231->287 PF02080 * TrkA_C 6e-06 42.1 %
:RPS:PFM   326->382 PF02080 * TrkA_C 9e-07 42.9 %
:HMM:PFM   11->556 PF03600 * CitMHS 3e-77 30.9 330/349  
:HMM:PFM   520->602 PF03600 * CitMHS 5.3e-10 27.7 83/349  
:BLT:SWISS 1->608 YFBS_ECOLI 0.0 89.5 %
:PROS 556->572|PS01271|NA_SULFATE
:TM
:REPEAT 2|48->198|459->606
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70332.1 GT:GENE ACF70332.1 GT:PRODUCT citrate transporter GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2488766..2490592) GB:FROM 2488766 GB:TO 2490592 GB:DIRECTION - GB:PRODUCT citrate transporter GB:NOTE identified by match to protein family HMM PF02080; match to protein family HMM PF03600; match to protein family HMM PF06808 GB:PROTEIN_ID ACF70332.1 GB:DB_XREF GI:194410113 LENGTH 608 SQ:AASEQ MNGELIWVLSLLAIAVVLFATGKVRMDAVALFVIVAFVLSGTLTLPEAFSGFSDPNVILIAALFIIGDGLVRTGVATVVGTWLVKMAGSSEIKMLVLLMITVAGLGAFMSSTGVVAIFIPVVLSVSMHMQTSPSRLMMPLSFAGLISGMMTLVATPPNLVVNSELLREGLHGFNFFSVTPLGIVVLALGIVYMLVMRFMLKGDAPGQQAGKRRTFRDLIREYRLTGRARRLAIRPGSPMVGQRLDDLKLRERYGANVIGVERWRRFRRVIVNVNGVSEFRARDVLLIDMSAAEVDLREFCAEQLLEPMVLRGEYFSDQALDVGMAEISLIPESELIGKSVREIAFRTRYGLNVVGLKRDGVALEGSLADEPLLMGDIILVVGNWKLISLLGQKGRDFVVLNMPVEVSEASPAHSQAPHAIFCLVLMVALMLTDEIPNPIAAIIACLLMGKFRCIDAESAYKAIHWPSIILIVGMMPFALALQKTGGVSLVVQGLMDIGGGYGPYMMLGCLFVLCAVIGLFISNTATAVLMAPIALAAAKSMGVSPYPFAMAVAMAASAAFMTPVSSPVNTLVLGPGNYSFSDFVKLGVPFTLIVMAVCIVMIPMLFPF GT:EXON 1|1-608:0| BL:SWS:NREP 1 BL:SWS:REP 1->608|YFBS_ECOLI|0.0|89.5|608/610| PROS 556->572|PS01271|NA_SULFATE|PDOC00978| TM:NTM 10 TM:REGION 13->35| TM:REGION 59->81| TM:REGION 99->121| TM:REGION 139->161| TM:REGION 177->199| TM:REGION 372->393| TM:REGION 423->445| TM:REGION 461->483| TM:REGION 512->534| TM:REGION 578->600| NREPEAT 1 REPEAT 2|48->198|459->606| SEG 28->39|avalfvivafvl| SEG 525->538|atavlmapialaaa| SEG 549->561|amavamaasaafm| RP:PDB:NREP 1 RP:PDB:REP 255->398|2bkoA|2e-11|17.5|137/190| RP:PFM:NREP 3 RP:PFM:REP 9->200,420->519|PF03600|3e-28|42.3|289/340|CitMHS| RP:PFM:REP 231->287|PF02080|6e-06|42.1|53/71|TrkA_C| RP:PFM:REP 326->382|PF02080|9e-07|42.9|56/71|TrkA_C| HM:PFM:NREP 2 HM:PFM:REP 11->556|PF03600|3e-77|30.9|330/349|CitMHS| HM:PFM:REP 520->602|PF03600|5.3e-10|27.7|83/349|CitMHS| GO:PFM:NREP 8 GO:PFM GO:0015137|"GO:citrate transmembrane transporter activity"|PF03600|IPR004680| GO:PFM GO:0015746|"GO:citrate transport"|PF03600|IPR004680| GO:PFM GO:0016021|"GO:integral to membrane"|PF03600|IPR004680| GO:PFM GO:0055085|"GO:transmembrane transport"|PF03600|IPR004680| GO:PFM GO:0006813|"GO:potassium ion transport"|PF02080|IPR006037| GO:PFM GO:0008324|"GO:cation transmembrane transporter activity"|PF02080|IPR006037| GO:PFM GO:0006813|"GO:potassium ion transport"|PF02080|IPR006037| GO:PFM GO:0008324|"GO:cation transmembrane transporter activity"|PF02080|IPR006037| RP:SCP:NREP 2 RP:SCP:REP 229->287|1vctA2|1e-07|33.9|56/94|d.286.1.1| RP:SCP:REP 321->387|1vctA2|2e-13|22.4|67/94|d.286.1.1| HM:SCP:REP 208->287|2fy8A2|1.3e-06|31.6|76/0|d.286.1.1|1/2|TrkA C-terminal domain-like| HM:SCP:REP 302->390|2fy8A2|6.6e-15|37.3|83/0|d.286.1.1|2/2|TrkA C-terminal domain-like| OP:NHOMO 463 OP:NHOMOORG 325 OP:PATTERN -------1----------------211112-1------11111---21-----------1-------- -----------------11-1---2-111111-----1-----------------------------------------------2--2221-2------1--2----3----------------------1---122221-----121-221----11111111------111111111111111------------------------1----------11-1------1--------------------------------11-------------------------------------------------------------------------1-------------1-----2---1-----------11--2-1111-------------1111---11-1---1--1--2-2--11122122222--1213232322222-------------11-------------------------------1331----------------------------------------------------------------------1-11321-322-3-------1-2-2-111121-----------------------------22-23-212111---1122------2-111--11112------111111-1111111111-11-111111111111111233211111313132233332321311111111--111111111111---311--111-1-112-2221111----1--1------------11111---411113-------------1111-----11-1111111111111111113------------------------------------------------------22 ------1-----------------------------------------------------------------------------------------------------13-----------------------------------------------------------------1431A3331-1------221---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 23.2 SQ:SECSTR ##############################################################################################################################################################################################################################################################HHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHcccE###EEEEEccTTcTTTTccHHHHTHHHHHccEEEEEEETTEEEEcccTTccccTTcEEEEEEcHHHHHHHHHHHTTcc################################################################################################################################################################################################################## DISOP:02AL 1-1,201-221,303-321| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHcHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccEEEEEEccccccccccHHHHHccHHcccEEEEEEEccccccEEEccccccEEccccEEEEEccHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEccccccccccHHHcccHHHcccEEEEEEEccEEEcccccccEEccccEEEEEEcHHHHHHHHHHHccEEEccccccHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //