[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70341.1
DDBJ      :             succinate dehydrogenase iron-sulfur subunit
Swiss-Prot:DHSB_SALTY   RecName: Full=Succinate dehydrogenase iron-sulfur subunit;         EC=1.3.99.1;

Homologs  Archaea  50/68 : Bacteria  641/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
a.1.2d.15.4
:239 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->239 1nekB PDBj e-139 96.6 %
:RPS:PDB   3->237 2bs2B PDBj 2e-36 29.1 %
:RPS:SCOP  1->107 1kf6B2  d.15.4.2 * 9e-19 39.2 %
:RPS:SCOP  108->237 1nekB1  a.1.2.1 * 3e-21 98.5 %
:HMM:SCOP  2->107 1nekB2 d.15.4.2 * 4.1e-34 43.4 %
:HMM:SCOP  108->239 1nekB1 a.1.2.1 * 1e-42 36.4 %
:HMM:PFM   206->220 PF00037 * Fer4 0.00057 46.7 15/24  
:BLT:SWISS 2->239 DHSB_SALTY e-143 100.0 %
:PROS 150->161|PS00198|4FE4S_FER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70341.1 GT:GENE ACF70341.1 GT:PRODUCT succinate dehydrogenase iron-sulfur subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 848911..849630 GB:FROM 848911 GB:TO 849630 GB:DIRECTION + GB:PRODUCT succinate dehydrogenase iron-sulfur subunit GB:NOTE identified by match to protein family HMM TIGR00384 GB:PROTEIN_ID ACF70341.1 GB:DB_XREF GI:194410122 LENGTH 239 SQ:AASEQ MMKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALTQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA GT:EXON 1|1-239:0| SW:ID DHSB_SALTY SW:DE RecName: Full=Succinate dehydrogenase iron-sulfur subunit; EC=1.3.99.1; SW:GN Name=sdhB; OrderedLocusNames=STM0735; SW:KW 2Fe-2S; 3Fe-4S; 4Fe-4S; Complete proteome; Electron transport; Iron;Iron-sulfur; Metal-binding; Oxidoreductase; Transport;Tricarboxylic acid cycle. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 2->239|DHSB_SALTY|e-143|100.0|238/238| GO:SWS:NREP 10 GO:SWS GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|2Fe-2S| GO:SWS GO:0051538|"GO:3 iron, 4 sulfur cluster binding"|3Fe-4S| GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006810|"GO:transport"|Transport| GO:SWS GO:0006099|"GO:tricarboxylic acid cycle"|Tricarboxylic acid cycle| PROS 150->161|PS00198|4FE4S_FER_1|PDOC00176| BL:PDB:NREP 1 BL:PDB:REP 2->239|1nekB|e-139|96.6|238/238| RP:PDB:NREP 1 RP:PDB:REP 3->237|2bs2B|2e-36|29.1|230/239| HM:PFM:NREP 1 HM:PFM:REP 206->220|PF00037|0.00057|46.7|15/24|Fer4| RP:SCP:NREP 2 RP:SCP:REP 1->107|1kf6B2|9e-19|39.2|102/105|d.15.4.2| RP:SCP:REP 108->237|1nekB1|3e-21|98.5|130/132|a.1.2.1| HM:SCP:REP 2->107|1nekB2|4.1e-34|43.4|106/106|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 108->239|1nekB1|1e-42|36.4|132/0|a.1.2.1|1/1|alpha-helical ferredoxin| OP:NHOMO 1191 OP:NHOMOORG 878 OP:PATTERN 11-1-11111111111112111-11111111111111111111---11-1---1-------1111-11 -2-12---------22233-321122333332222221431111121-1111111111--112122223111111111-112122222---------------11---1-11111111111111111111211132--------111111111-1----1---12111111-1-----1----11111---1111111111111111111111111111111111------1111111111111111111111---------------------------------------------------------------------------------------11---------2--1111-12---2---------1-111111111121111111111111111111111-11111212111111111111111111111122212211111111111111-11111121111111111111111111111111111111-111121221212222244122222-2121111111231111111111222121-1-221111111111212--1--111121222-----1--1-----11-31221122221111111111122323--221111111122333313222232222322--11121------22222212222222222-221222222222222222222222222222222222222222222222222112222222222221111111111111111111111111111111111111111111111111111111111111111111111112222222222222211111111111111--1-------------------------------------------------------- 11--111-522-11111111111111111111111111111111111111111111111111111111112111111-1111111111-111111121111-1212-11-1242211111112111131161-11211111111-11111111111211-2311112211211211111K1111112831361122121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 239 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEEccTTcTTccEEEEEEEEccTTccccHHHHHHHHHHTcTTcccccccccccccTTEEEETTEEEEGGGccGGGcTcTTcEEEEEccTTcEEEETTEEEcHHHHHHHHHHTTcccccccccTcccccccHHHHHHHHHHHTcccccHHHHTcHHHHHcTTccHTHHHHHHHHHHHTcTTccccHHHHHHHHccTTGGGcccccHHHHHcTTcccHHHHHHHHHHHHTTccc DISOP:02AL 1-1,238-240| PSIPRED ccEEEEEEEEEcccccccccEEEEEEEccccccccHHHHHHHHHHHccccEEccccccccccccEEEEccEEccHHEEEHHHHcccccEEEEEEcccccEEEEccccHHHHHHHHHHcccEEcccccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccHHHHccccccHHHHHHHHHHHHHHHHc //