[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70345.1
DDBJ      :             type III secretion low calcium response chaperone LcrH/SycD
Swiss-Prot:SICA_SALTY   RecName: Full=Chaperone protein sicA;AltName: Full=Salmonella invasin chaperone;

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.8
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->152 3gz1A PDBj 4e-52 60.8 %
:RPS:PDB   35->129 2cfuA PDBj 2e-06 8.4 %
:RPS:SCOP  34->159 1w3bA  a.118.8.1 * 2e-05 15.1 %
:HMM:SCOP  22->156 2fbnA1 a.118.8.1 * 7.2e-10 19.4 %
:HMM:PFM   37->70 PF07720 * TPR_3 1e-15 41.2 34/36  
:HMM:PFM   71->104 PF07720 * TPR_3 2.6e-14 41.2 34/36  
:BLT:SWISS 1->165 SICA_SALTY 1e-95 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70345.1 GT:GENE ACF70345.1 GT:PRODUCT type III secretion low calcium response chaperone LcrH/SycD GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(3005412..3005909) GB:FROM 3005412 GB:TO 3005909 GB:DIRECTION - GB:PRODUCT type III secretion low calcium response chaperone LcrH/SycD GB:NOTE identified by match to protein family HMM PF07720; match to protein family HMM TIGR02552 GB:PROTEIN_ID ACF70345.1 GB:DB_XREF GI:194410126 LENGTH 165 SQ:AASEQ MDYQNNVSEERVAEMIWDAVSEGATLKDVHGIPQDMMDGLYAHAYEFYNQGRLDEAETFFRFLCIYDFYNPDYTMGLAAVCQLKKQFQKACDLYAVAFTLLKNDYRPVFFTGQCQLLMRKAAKARQCFELVNERTEDESLRAKALVYLEALKTAETEQHSEQEKE GT:EXON 1|1-165:0| SW:ID SICA_SALTY SW:DE RecName: Full=Chaperone protein sicA;AltName: Full=Salmonella invasin chaperone; SW:GN Name=sicA; Synonyms=spaT; OrderedLocusNames=STM2886; SW:KW 3D-structure; Activator; Chaperone; Complete proteome; Cytoplasm;Transcription; Transcription regulation; Virulence. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->165|SICA_SALTY|1e-95|100.0|165/165| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| BL:PDB:NREP 1 BL:PDB:REP 10->152|3gz1A|4e-52|60.8|143/144| RP:PDB:NREP 1 RP:PDB:REP 35->129|2cfuA|2e-06|8.4|95/627| HM:PFM:NREP 2 HM:PFM:REP 37->70|PF07720|1e-15|41.2|34/36|TPR_3| HM:PFM:REP 71->104|PF07720|2.6e-14|41.2|34/36|TPR_3| RP:SCP:NREP 1 RP:SCP:REP 34->159|1w3bA|2e-05|15.1|126/388|a.118.8.1| HM:SCP:REP 22->156|2fbnA1|7.2e-10|19.4|134/0|a.118.8.1|1/1|TPR-like| OP:NHOMO 73 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----1111-1------------------------------1---------------------------1----------------------------------------------1-----------------------------------------------2111-1---11-11111--1211-2--1----------11111111111111111--111--22-211111-11-1---1------------1-----------------------------11----------------------------------11---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 93.3 SQ:SECSTR ####HHHHTHHHHHHHHHHHHTTcEEccccTHHcTcHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHHHccHHHTccccccGGGccccccccccc####### DISOP:02AL 1-5,151-166| PSIPRED cccccccccHHHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHcc //