[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70349.1
DDBJ      :             transposase subfamily
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  200/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1
:88 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->52 1hcrA  a.4.1.2 * 5e-06 15.7 %
:HMM:SCOP  1->41 1hcrA_ a.4.1.2 * 7.6e-06 36.6 %
:RPS:PFM   2->68 PF01527 * Transposase_8 2e-04 38.8 %
:HMM:PFM   1->71 PF01527 * Transposase_8 5.9e-21 31.0 71/76  
:BLT:SWISS 1->88 LCRS_YERPS 4e-25 59.1 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70349.1 GT:GENE ACF70349.1 GT:PRODUCT transposase subfamily GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2881572..2881838) GB:FROM 2881572 GB:TO 2881838 GB:DIRECTION - GB:PRODUCT transposase subfamily GB:NOTE identified by match to protein family HMM PF01527 GB:PROTEIN_ID ACF70349.1 GB:DB_XREF GI:194410130 LENGTH 88 SQ:AASEQ MRKARFTEHQIIAVIKSVEAGRTVKDACREAGISEATYYNWKSRYGGMEPSDIKKIKDLEDENRRLKQMFADLSLENRALKDVIEKKL GT:EXON 1|1-88:0| BL:SWS:NREP 1 BL:SWS:REP 1->88|LCRS_YERPS|4e-25|59.1|88/88| COIL:NAA 29 COIL:NSEG 1 COIL:REGION 54->82| RP:PFM:NREP 1 RP:PFM:REP 2->68|PF01527|2e-04|38.8|67/78|Transposase_8| HM:PFM:NREP 1 HM:PFM:REP 1->71|PF01527|5.9e-21|31.0|71/76|Transposase_8| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01527|IPR002514| GO:PFM GO:0004803|"GO:transposase activity"|PF01527|IPR002514| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF01527|IPR002514| RP:SCP:NREP 1 RP:SCP:REP 2->52|1hcrA|5e-06|15.7|51/52|a.4.1.2| HM:SCP:REP 1->41|1hcrA_|7.6e-06|36.6|41/52|a.4.1.2|1/1|Homeodomain-like| OP:NHOMO 1278 OP:NHOMOORG 200 OP:PATTERN -------------------------------------------------------------------- 4--1-----------------1--8-------2156-----------3---------------------------------------------------------8-4----------------2------21--3-----143-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---44------14118--1421--2111111-116-7C22-245-3--111-4--4435-29--6B4--6-165-KJKKKKKK2CB218--------------------------------8-3---1--C222G2-3****13-15BB7121731-11----9---1-11--1-11------3---------C--1------956-123-----11----2--11---------------------------------13------------3------3---1----1---------1-1-411---1-11----------13-----------14711----422222-111-2-312---------635454255154---------122-3--------------------------4-6-21313-----1---2---------------------------1-DIWINPZa--------11---------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,47-57| PSIPRED cccccccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //