[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70354.1
DDBJ      :             acid shock protein repeat
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->60 PF06392 * Asr 6.9e-10 89.5 19/19  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70354.1 GT:GENE ACF70354.1 GT:PRODUCT acid shock protein repeat GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1609195..1609446) GB:FROM 1609195 GB:TO 1609446 GB:DIRECTION - GB:PRODUCT acid shock protein repeat GB:NOTE identified by match to protein family HMM PF06392 GB:PROTEIN_ID ACF70354.1 GB:DB_XREF GI:194410135 LENGTH 83 SQ:AASEQ MKKVLALVVAAAMGLSSAAFAAETATPAKTATPAKTTQNTQHHKKQHKKTVEQKAQAAKKHQKKDGKKAPAKSTSKTTSQPAA GT:EXON 1|1-83:0| TM:NTM 1 TM:REGION 4->26| SEG 4->50|vlalvvaaamglssaafaaetatpaktatpakttqntqhhkkqhkkt| SEG 53->82|qkaqaakkhqkkdgkkapakstskttsqpa| HM:PFM:NREP 1 HM:PFM:REP 42->60|PF06392|6.9e-10|89.5|19/19|Asr| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,30-84| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //