[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70367.1
DDBJ      :             transporter, small conductance mechanosensitive ion channel
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  242/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.38.1d.58.43
:415 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   248->339 3da7G PDBj 3e-26 16.7 %
:RPS:SCOP  187->253 2oauA1  b.38.1.3 * 1e-13 23.1 %
:RPS:SCOP  322->397 2oauA2  d.58.43.1 * 1e-11 16.4 %
:HMM:SCOP  185->253 2oauA1 b.38.1.3 * 6.5e-14 32.8 %
:RPS:PFM   150->397 PF00924 * MS_channel 3e-24 37.6 %
:HMM:PFM   142->398 PF00924 * MS_channel 4.9e-71 39.6 207/207  
:BLT:SWISS 1->414 YBDG_SHIFL 0.0 88.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70367.1 GT:GENE ACF70367.1 GT:PRODUCT transporter, small conductance mechanosensitive ion channel GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(674065..675312) GB:FROM 674065 GB:TO 675312 GB:DIRECTION - GB:PRODUCT transporter, small conductance mechanosensitive ion channel GB:NOTE identified by match to protein family HMM PF00924 GB:PROTEIN_ID ACF70367.1 GB:DB_XREF GI:194410148 LENGTH 415 SQ:AASEQ MQELISRVEDLAGIEMNHTTSLVVIFGIIFLTAVVVHIILHWIVLRAFEKRASASSRLWLQIITQNKLFHRLAFTLQGIIVNIQAALWLQKGSEAADILTTCAQLWIMTYALLSLFSLLDVIFNLSQKWPAASQLPLKGIFQGIKLIGAIIVGILMISLLIGQSPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDIGLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSINIDATSIHFLDDDEKQRLLTAQLLKPYLTSRHQEIDEWNKQLDAPESALNHRRMTNIGTFRAYLNEYLRHHPRIRKDMTLMVRQLAPDDHGLPIEIYAFTNTVVWLEYESIQADIFDHIFAVVEEFGLRIHQTPTGSDIRALSGTLRH GT:EXON 1|1-415:0| BL:SWS:NREP 1 BL:SWS:REP 1->414|YBDG_SHIFL|0.0|88.9|414/415| TM:NTM 5 TM:REGION 23->45| TM:REGION 72->94| TM:REGION 100->122| TM:REGION 141->163| TM:REGION 172->194| SEG 34->45|vvvhiilhwivl| RP:PDB:NREP 1 RP:PDB:REP 248->339|3da7G|3e-26|16.7|90/102| RP:PFM:NREP 1 RP:PFM:REP 150->397|PF00924|3e-24|37.6|194/203|MS_channel| HM:PFM:NREP 1 HM:PFM:REP 142->398|PF00924|4.9e-71|39.6|207/207|MS_channel| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF00924|IPR006685| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00924|IPR006685| RP:SCP:NREP 2 RP:SCP:REP 187->253|2oauA1|1e-13|23.1|65/67|b.38.1.3| RP:SCP:REP 322->397|2oauA2|1e-11|16.4|73/101|d.58.43.1| HM:SCP:REP 185->253|2oauA1|6.5e-14|32.8|67/0|b.38.1.3|1/1|Sm-like ribonucleoproteins| OP:NHOMO 259 OP:NHOMOORG 245 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------2222-2-----1-1111--------------------11-11111-11-----------1------------------------------------------2-----------------------------------------1-------------------------------------------------------------------------------------------11-----------------------------------------------------111111-------------11-1111---1--------------------------------------------------------------------1111111111111----------111111111111----111-------1--1111--------111---------1--------------1---1-11-----------------------1---11111------1-11111111-1-1--11-1--121211111111111111111111-------------1---1111111111111-1121111111111-1111122211--2111111111111111111111111---11111111111---1-----------------------------1111111----1111111111111111-11111-11-1--21-111111----11--------1111------------------1---------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 21.7 SQ:SECSTR #######################################################################################################################################################################################################################################################ccccEEEcccccccccccEEEEETTccEEEEccTTcccEEEcccHHHHHHHccccTTEEcHHHHHHTTccTTTHcTEEEEE##EccTTcccc############################################################################ DISOP:02AL 1-1,412-416| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccccEEEEEEEEEEEEEEEcccccEEEEEccHHcccEEEEccccccccEEEEEEEEEEEccccccccHHHHHHHcccHHHHHHHHccHHHHHHHHHHccccccccccccEEcHHHHHHHHHHHHHHccccccccEEEEEEcccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHcc //